Navigation Links
Cepheid Receives Grant to Develop Sample Processing and Amplification Methods for Detection of Bloodstream Bacteria
Date:3/20/2012

SUNNYVALE, Calif., March 20, 2012 /PRNewswire/ -- Cepheid (NASDAQ: CPHD) today announced that, together with the University of Medicine and Dentistry of New Jersey (UMDNJ), it has received a grant from the National Institutes of Health to develop sample processing and amplification methods for highly-sensitive detection of bloodstream bacteria using nested polymerase chain reaction (PCR) on the GeneXpert® System. The $1.3 million grant is for the first year of an expected five-year, $5.5 million program.

While the program is being administered by the National Institute of Allergy and Infectious Diseases (NIAID) through its Partnerships for Biodefense special emphasis program, the company also expects to be able to employ the technology in future clinical products, including planned Xpert® tests for sepsis, ventilator pneumonia, and other critical infectious diseases.

"Cepheid's scientists will focus primarily on sample preparation methods for infectious agents from a wide variety of difficult sample types, especially whole blood — one of the most difficult specimens for sepsis detection," said John Bishop, Cepheid's Chief Executive Officer. "Clinicians want accurate, rapid results directly from a patient specimen without waiting for culture results. This program is expected to contribute to the advancement of products where difficult sample types are present."

Because even an extremely low concentration of bacteria present in a patient's blood can cause life-threatening sepsis, tests to detect blood stream infections (BSI) must be highly sensitive. Most blood stream infections are currently diagnosed by performing a series of blood cultures, a time-consuming process that typically takes days to produce a positive result, and even longer to predict treatment susceptibility.

The overarching goal of the project, scheduled to run through Febr
'/>"/>

SOURCE Cepheid
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Cepheid to Webcast Upcoming Financial Presentations
2. Cepheid Reports Fourth Quarter and Full Year 2011 Results
3. Cepheid Welcomes Senior Vice President of Human Resources
4. Cepheid Receives FDA Clearance for Xpert Flu, Delivering Simultaneous Detection and Differentiation of Flu A, Flu B, and 2009 H1N1 Strain
5. Cepheid Schedules 2010 Third Quarter Financial Results Announcement and Webcast
6. Cepheid to Webcast Upcoming Financial Presentations
7. Cepheid Expands Leadership Team With Appointment of Executive Vice President of Worldwide Commercial Operations
8. Cepheid Schedules 2009 Third Quarter Financial Results Announcement and Webcast
9. Cepheid Schedules 2009 Second Quarter Financial Results Announcement and Webcast
10. Cepheid Announces Symposium Speakers and Program Highlights for 19th European Congress of Clinical Microbiology and Infectious Diseases (ECCMID)
11. Cepheid Reports 2009 First Quarter Results
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: