Navigation Links
Cellular Dynamics and Roche Conduct 'Stem Cells in Drug Discovery and Development' Workshop at the Society of Toxicology Annual Meeting
Date:3/2/2010

;s.prop15='85942202';s.tl(this,'o','ExternalLink');" target='_blank' href="http://www.roche.com/">www.roche.com.

About Cellular Dynamics International, Inc.

Cellular Dynamics International, Inc. (CDI) is a leading developer of next-generation stem cell technologies for drug development and personalized medicine applications.  CDI harnesses the power of pluripotent stem cells and their ability to differentiate into any cell type for world-class drug development tools.  In addition, it is the leader in iPS technology, the production of pluripotent stem cell lines from adult tissue.  CDI was founded in 2004 by James Thomson, a pioneer in human embryonic stem cell research at the University of Wisconsin-Madison, and Tactics II Ventures, a Wisconsin-based private equity fund.  CDI's facilities are located in Madison, Wisconsin.  See www.cellulardynamics.com.


'/>"/>
SOURCE Cellular Dynamics International
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4 5 6

Related biology technology :

1. Intra-Cellular Therapies Provides Overview of its Proprietary Portfolio of Compounds for the Treatment of Female Sexual Dysfunction (FSD)
2. EpiCept to Present Pre-clinical Advances of Myc Oncogene Directed Drug Discovery at Assays and Cellular Targets Conference
3. National Stem Cell Holding Announces Patent Application for Newly Discovered Cellular Derived Biomaterials for Anti-Aging Applications
4. Chris Tihansky Appointed President of In Vivo Cellular Imaging Leader Cellvizio Inc.
5. First Live U.S. Demonstration of Cellvizio GI In Vivo Cellular Imaging Technology to Occur at Johns Hopkins Conference
6. Cellular construction methods emulated
7. Having Penetrated Israels Domestic Telephony Market, 012 Smile.Communications Prepares for Its Next Goal: Entering Israels Cellular Market
8. Sangamo BioSciences Announces Presentation of Phase 1 Data of ZFP Therapeutic at International Society for Cellular Therapy (ISCT) Meeting
9. New insights into cellular reprogramming revealed by genomic analysis
10. Cellumen to Collaborate With the NCTR of the FDA to Apply Cellular Systems Biology (CSB(TM)) to Predictive Toxicology
11. ChanTest to Highlight the Worlds Largest Catalog of Ion Channel-Expressing Cell Lines and Discovery Services at Assays & Cellular Targets Conference, Booth 11
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... . -- Fiserv, Inc. said its Interactive Technologies ... A. Weber chief operating officer. In her new ... the Interactive Technologies Advantage Fee System software and ... clients. , ,Weber joins Interactive Technologies from ...
... biotechnology sector, she began to notice a certain pattern: Scientists ... the business world to be a much different place than ... , ,"Along the way, I realized that it was that ... a product just as effectively as a competitor," Villars said. ...
... J.J. Keller & Associates is launching Prospera ... tested on more than 13,000 human resources professionals, the ... built around five areas of concern for human resources ... on how those areas affect a company's bottom line; ...
Cached Biology Technology:Can tech people be business leaders? Upcoming seminar may have the answer 2Can tech people be business leaders? Upcoming seminar may have the answer 3J.J. Keller, Modine Manufacturing, Gustave A. Larson Co., Esker, Firstlogic, Software One 2
(Date:6/18/2013)... D.C. June 18, 2013 Joshua Obar, Ph.D., ... has been honored with a 2013 ICAAC Young Investigator ... regulation of immunological memory responses to infection. , ... University in 2001 and went on to complete his ... 2006. He performed his Ph.D. thesis research in ...
(Date:6/18/2013)... Irvine, Calif., June 18, 2013 The herbal extract ... relief was found to increase the lifespan of fruit ... to UC Irvine researchers. , But it,s how ... root, did this that grabbed the attention of study ... Rhodiola works in a manner completely unrelated ...
(Date:6/18/2013)... to a chemical modification of DNA and this ... the DNA sequence. Until now, scientists believed that ... certain genes. Today, a team of researchers from ... Emmanouil Dermitzakis, Louis-Jeantet Professor at the Faculty of ... case and that DNA methylation may play both ...
Breaking Biology News(10 mins):The American Society for Microbiology honors Joshua Obar 2Herbal extract boosts fruit fly lifespan by nearly 25 percent, UCI study finds 2The secret of DNA methylation 2
... A newly discovered mechanism by which an infectious fungus ... virulence, according to Howard Hughes Medical Institute investigators at ... in light following fungal invasion of the human body ... sparks infection, the researchers said. , The discovery in ...
... irreversible damage to the heart that can cause ... the limited ability of the myocardium to regenerate ... University now document the existence of a previously ... with therapeutic potency for myocardial tissue regeneration following ...
... (WHO) warned about increased risk of vector-borne diseases ... areas in Southeast Asia. Nearly four weeks after ... the organization is strengthening its disease surveillance, stagnant ... multiply to sufficient levels, to potentially cause severe ...
Cached Biology News:Light therapy may combat fungal infections, new evidence suggests 2Light therapy may combat fungal infections, new evidence suggests 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 2WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 4
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: