Navigation Links
Cellectricon Partners With The Automation Partnership - Bringing Next Generation Ion Channel Screening System to Market.
Date:12/3/2008

GOTHENBURG, Sweden, December 3 /PRNewswire/ -- Cellectricon, a leading provider of screening solutions for drug discovery, today announced the signing of a collaborative agreement with The Automation Partnership (TAP) in the UK, manufacturers of advanced automated systems for cell culture, sample management and high throughput screening applications. Under the agreement TAP will co-develop and manufacture the Dynaflow(R)HT System, Cellectricon's next generation high throughput ion channel screening platform. Dynaflow(R)HT will be launched and commercially available in 2009.

Addressing the limitations of current ion channel screening technologies, the Dynaflow(R)HT yields an unmatched level of automated throughput while still delivering unique measurement data quality. The concept and technology has been developed and validated over the last three years by Cellectricon in partnership with AstraZeneca.

"We are excited to partner with TAP who are world-renowned for manufacturing industrial quality automation," says Jonas Ohlsson, CEO at Cellectricon. "To bring this fully automated state-of-the-art high throughput electrophysiology system to the market is a milestone for ion channel screening. The system offers unmatched throughput, cost per data point and reliability/predictability."

"The Automation Partnership (TAP) are very pleased to have the opportunity to work with Cellectricon in automating their unique high throughput microfluidic screening platform," says Andy Morffew Chief Executive Officer. "We are looking forward to supporting this system with a wide range of excellent technical and professional services, designed to ensure customers gain optimum return from their capital investment."

About Cellectricon

Cellectricon AB, a Swedish biotech company, successfully provides groundbreaking products to the pharmaceutical and biotechnology industries. The company utilizes
'/>"/>

SOURCE Cellectricon AB
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Share Issue Gives Cellectricon SEK 89 Million to Continue its Rapid Market Expansion
2. Cellectricon and AstraZeneca - Partners in New High Throughput Ion Channel Drug Discovery Technology
3. Cellectricon Receives Milestone Order for Cellaxess(R)HT, the Worlds First High Throughput RNAi Screening System
4. Operon Biotechnologies and DNA2.0 Announce Co-Marketing and Technology Development Partnership
5. NuVasive to Present at Thomas Weisel Partners Healthcare Conference
6. Monogram Biosciences to Present at the Thomas Weisel Partners Healthcare Conference 2007
7. GenVault Partnership with Genome Quebec Brings $3.3 Million Sale of Dynamic Archive Product
8. ADVENTRX Pharmaceuticals to Present at the 2007 Thomas Weisel Partners Healthcare Conference
9. Caliper Life Sciences Presentation at Thomas Weisel Partners Healthcare Conference to be Webcast
10. SuperGen to Present at Thomas Weisel Partners Healthcare Conference September 5th
11. NxStage Medical to Present at the Thomas Weisel Partners Healthcare Conference on September 5, 2007
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... Calif. , Dec. 19, 2014  Roche (SIX: ... of Bina Technologies, Inc. (Bina), a privately held ... , USA. Bina provides a big data ... generation sequencing (NGS) data. Bina,s proprietary on-market Genomic ... and academic researchers to perform fast and scalable ...
(Date:12/19/2014)... December 18, 2014 BioPlus ... leading specialty pharmacies, has an expanded team of ... pharmacy consultants for prescriber offices in their regions, ... , “We have a variety of Regional Pharmaceutical ... those specializing in hepatitis C help prescribers understand ...
(Date:12/19/2014)... 18, 2014 Reports from CDC ... States suffer from one or more chronic health conditions ... Medication can address some of these diseases, but may ... many sufferers face. While implanted nerve stimulation devices today ... whole nerve, which can induce side effects. , ...
(Date:12/19/2014)... Diego, CA (PRWEB) December 18, 2014 ... a limited time special on Sartorius Biohit products ... Free on mLINE pipettes, Picus Electronic Pipette Trade-in Program, ... by Health and Safety officers around the world. They ... manual pipetting. Other features include:, ,     Full ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3Draper Wins GSK Funding for Smaller, Smarter Implantable Devices 2Major Pipette Distributor Pipette.com Announces Sartorius Year End Specials 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: