Navigation Links
Cell Press Delivers the News
Date:11/12/2010

".cf_pushbutton_activate").live("mouseover", function (){ //Omniture Link Tracking Code /*var s=s_gi(s_account); s.linkTrackVars='eVar3,prop15,prop16'; s.linkTrackEvents='None'; s.eVar3=s.prop16; s.prop15='Test'; //Newsrelease id s.prop16='CrowdFactory_Share'; s.tl(this,'o', 'CrowdFactory_Share');*/ var s=s_gi(s_account);s.linkTrackVars='prop5,eVar3,prop15,prop16,prop49,events';s.linkTrackEvents='event12';s.prop5='share it release';s.eVar3=s.prop5; s.prop15='107481698';s.prop16='CrowdFactory_Share';s.prop5+='_'+s.prop16;s.prop49=s.pageName;s.events='event12';s.tl(this,'o','CrowdFactory_Share'); }); cf_jq(".cf_dialog_footer button").live("mouseup", function (){ var socialText = this.innerHTML.replace("Post to ", ""); /*s.linkTrackVars='eVar3,prop15,prop16'; s.linkTrackEvents='None'; s.prop16='CrowdFactory_'+socialText; s.eVar3=s.prop16; s.prop15='Test'; //Newsrelease id s.tl(this,'o', 'CrowdFactory_'+socialText);*/ var s=s_gi(s_account);s.linkTrackVars='prop5,eVar3,prop15,prop16,prop49,events';s.linkTrackEvents='event12';s.prop5='share it release';s.eVar3=s.prop5; s.prop15='107481698';s.prop16='CrowdFactory_'+socialText;s.prop5+='_'+s.prop16;s.prop49=s.pageName;s.events='event12';s.tl(this,'o','CrowdFactory_'+socialText); }); });  

CAMBRIDGE, Massachusetts, November 12, 2010 /PRNewswire/ --

- Announcing Cell DNA - Daily News Aggregator

- A Free Daily News Aggregation Service in the Life Sciences

To enable scientists to easily keep up-to-date with life science focused news and information, Cell Press is delighted to announce the launch of Cell DNA (Daily News Aggregator, accessible online at http://news.cell.com.

Cell DNA is a news aggregator that compiles life sciences-focused news stories from an extensive range sources and delivers them online, and in a daily email digest format, free of charge to subscribers. In addition to receiving daily news digests, readers can comment on,
'/>"/>

SOURCE Cell Press
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7

Related biology technology :

1. Pressure BioSciences, Inc. to Discuss Second Quarter 2008 Financial Results and Provide Business Update
2. Pressure BioSciences, Inc. Reports Second Quarter 2008 Financial Results and Provides Business Update
3. [video] Jacques Tizabi, CEO of Universal Detection Technology Discusses Latest Purchase Order on WallSt.nets 3-Minute Press Show
4. [video] David Brown, President and CEO of LifeVantage Corporation, Discusses Record Page Views on WallSt.nets 3-Minute Press Show
5. Xceed Ziplex(R) System for Automated Gene-Expression Analysis Wins 2008 R&D 100 Award
6. Pressure BioSciences, Inc. Releases Novel, PCT-dependent Sample Preparation Kit for Systems Biology Studies
7. Vascular Biogenics Ltd. Presented With the Frost & Sullivan 2008 European Gene Expression Targeting Platform Technology Innovation Award
8. Landmark SYNTAX Trial Reports Comparable Safety Outcomes for Complex Patients Treated With TAXUS(R) Express2(TM) Stents or Bypass Surgery
9. Supelco(R) Expands Ascentis(R) Express HPLC Columns Line for High-Speed and High-Efficiency Separations
10. Expression Genetics EGEN-001 Named One of 10 Most Promising Oncology Products by Windhover
11. ChanTest to Highlight the Worlds Largest Catalog of Ion Channel-Expressing Cell Lines and Discovery Services at Ion Channel Targets, Booth 5
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... , a biopharmaceutical company developing cancer therapies, has announced ... been selected for preclinical testing and human clinical trials. ... safety assessment, it would submit to the U.S. ... application in late 2007, with human clinical trials expected ...
... Milwaukee, Wis - Understanding our genetic makeup ... to the point where DNA testing services, including ... shaping their own health management. Patients, however, will ... knowledge because most healthcare facilities are not yet ...
... The drive to make healthcare information technology interoperable ... applications, and a medical information technology company headquartered ... TeraMedica is lending its expertise to developing ... for the healthcare industry. Specifically, the expertise of ...
Cached Biology Technology:Healthcare slow to adopt genetic advances 2Healthcare slow to adopt genetic advances 3TeraMedica embraces open source project 2
(Date:3/20/2015)... , Mar. 20, 2015 Research and Markets ... addition of the "India Sensors Market Forecast ... The sensor market is projected to ... Consumer electronics, automotive, industrial and healthcare ... in the country. In addition, adoption of MEMS ...
(Date:3/19/2015)... Conn. , March 19, 2015  NXT-ID, Inc. (NASDAQ: ... authentication company focused on the growing mobile commerce market, announces ... in a news clip that aired this week on ... ) . In a segment "The Next Great ... wallet ,a new way to pay, and ,a really big ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... June 10, 2010The ongoing search for evidence of past or ... such as proteins in Martian soil, but their absence to ... happens to these carbon-based molecules is presented in an article ... Mary Ann Liebert, Inc. The article is available free online ...
... CLEMSON, S.C. With a new twist on an ... to store "waste" energy underground to cut heating and cooling ... Molz have received a $991,000 grant from the U.S. Department ... system that can be used as a model for energy ...
... Cornell University researchers recently stretched individual molecules and ... can be used as powerful new tools for nanoscale ... 11 issue of the journal Science, probes ... important when shrinking electronics to their ultimate small size ...
Cached Biology News:New model is proposed to explain absence of organic compounds on surface of Mars 2Clemson engineers to create model underground energy-storage facility 2Clemson engineers to create model underground energy-storage facility 3Stretching molecules yields new understanding of electricity 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: