Navigation Links
Cardium Presents First Quarter 2012 Financial Results and Recent Developments

, 2012Three Months Ended March 31,20122011Revenues$
--Cost of goods sold5,455--Gross profit15,023--Research and development(1,164,599)(491,574)Selling, general and administrative(1,509,761)(1,287,885)Loss from operations(2,659,337)(1,779,459)Interest income (expense), net1,1442,649Change in fair value of derivative liabilities64,15788,170Net loss $  (2,594,036)$ (1,688,640) 

Net  loss per common  share – basic and diluted $
(0.02) $
(0.02)Weighted average common shares outstanding  – basic and diluted 


83,097,967Selected Condensed Consolidated Balance Sheet DataMarch 31,

2012December 31,

2011Cash and cash equivalents

4,721,279Restricted cash

50,000200,000Accounts receivable


521,657434,130Prepaid expenses and other current assets

111,26668,204Property and equipment, net

111,701135,581Other long-term assets

1,910,4331,944,035Total assets

$   11,793,125$
7,503,229Accounts payable and accrued liabilities

,214,480Derivative liabilities

--85,506Long-term liabilities

105,353118,313Total liabilities

1,795,7521,418,299Stockholder's equity

9,997,3736,084,930Total liabilities and stockholder's equity

$   11,793,125$
7,503,299Cardium Therapeutics, Inc.Reconciliation of Non-GAAP MeasureAs of March 31, 2012Three Months Ended March 31,20122011Net Loss 

$ (2,594,036)

$ (1,688,640)Add (subtract)Stock-based compensation expense43,23933,915Change in fair value of derivative liabilities(64,157)(88,170)Non-GAAP net loss$ (2,614,954)$ (1,742,895)Non-GAAP net loss per common share – basic

SOURCE Cardium Therapeutics
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11

Related biology technology :

1. Cardium to Present at Upcoming Investor Conferences
2. Cardiums Exchange Listing Compliance Plan Accepted by NYSE Amex
3. Cardium Reports Excellagen Matrix Clinical Study Results Accepted for Publication by Peer-Reviewed Journal, and Updates Product Plans
4. Cardium Reports on Third Quarter 2010 Financial Results and Recent Developments
5. Cardium to Present at the LifeTech Capital Miami Medical Investors Conference
6. Cardium Gains Exclusive Access to Novel Polymer-Based Nitric Oxide Technology for Expansion of Wound Healing Product Portfolio
7. Cardium to Present at 10th Annual Biotech in Europe Investor Forum
8. Cardium Regains Listing Compliance With NYSE Amex
9. Cardium to Present at MDB Capital Groups 2010 Bright Lights Conference
10. Cardiums Exchange Listing Compliance Plan Accepted by NYSE AMEX
11. Cardium Reports on Third Quarter 2009 Financial Results and Recent Developments
Post Your Comments:
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: