Navigation Links
Bunge Limited to Expand Sugar and Bioenergy Business in Brazil
Date:12/24/2009

egal proceedings; our ability to complete, integrate and benefit from acquisitions, including the transactions discussed in this news release, dispositions, joint ventures and strategic alliances; changes in government policies, laws and regulations affecting our business, including agricultural and trade policies, tax regulations and biofuels legislation; and other factors affecting our business generally. The forward-looking statements included in this release are made only as of the date of this release, and except as otherwise required by federal securities law, we do not have any obligation to publicly update or revise any forward-looking statements to reflect subsequent events or circumstances.

SOURCE Bunge Limited


'/>"/>
SOURCE Bunge Limited
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Bunge Reports Fourth Quarter Net Income of $245 Million
2. Bunge Limited Schedules Third Quarter 2008 Earnings Release and Conference Call
3. RoundTable Healthcare Partners Closes Sale of MedAssist Holding, Inc. to Firstsource Solutions Limited
4. Sunrise Biotech Holding Limited Application For Admission to PLUS
5. Daval International Limited Gains Approval for Phase IIB Trial of AIMSPRO(R)
6. Alimera Sciences, pSivida Limited Amend Medidur(TM) FA Collaboration Agreement
7. Limited transparency in federal nanotech research may hamper development
8. Application for Listing of Shire Limited Ordinary Shares
9. Non-Safety-Related Voluntary Recall of a Limited Portion of DAYTRANA(TM) (Methylphenidate Transdermal System) Patches Announced
10. Masimo Initiates Limited Release of First-Ever Noninvasive and Continuous Hemoglobin Monitors
11. EnrichMap Announces New Program To Reduce Medical Patient Noncompliance And Offers Healthcare Organizations A Limited Trial Test Opportunity
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: