Navigation Links
Building 'invisible' materials with light
Date:7/28/2014

A new method of building materials using light, developed by researchers at the University of Cambridge, could one day enable technologies that are often considered the realm of science fiction, such as invisibility cloaks and cloaking devices.

Although cloaked starships won't be a reality for quite some time, the technique which researchers have developed for constructing materials with building blocks a few billionths of a metre across can be used to control the way that light flies through them, and works on large chunks all at once. Details are published today (28 July) in the journal Nature Communications.

The key to any sort of 'invisibility' effect lies in the way light interacts with a material. When light hits a surface, it is either absorbed or reflected, which is what enables us to see objects. However, by engineering materials at the nanoscale, it is possible to produce 'metamaterials': materials which can control the way in which light interacts with them. Light reflected by a metamaterial is refracted in the 'wrong' way, potentially rendering objects invisible, or making them appear as something else.

Metamaterials have a wide range of potential applications, including sensing and improving military stealth technology. However, before cloaking devices can become reality on a larger scale, researchers must determine how to make the right materials at the nanoscale, and using light is now shown to be an enormous help in such nano-construction.

The technique developed by the Cambridge team involves using unfocused laser light as billions of needles, stitching gold nanoparticles together into long strings, directly in water for the first time. These strings can then be stacked into layers one on top of the other, similar to Lego bricks. The method makes it possible to produce materials in much higher quantities than can be made through current techniques.

In order to make the strings, the researc
'/>"/>

Contact: Sarah Collins
sarah.collins@admin.cam.ac.uk
44-012-237-65542
University of Cambridge
Source:Eurekalert  

Page: 1 2

Related biology technology :

1. Scientists find protein-building enzymes have metamorphosed & evolved new functions
2. Hamilton Scientific Continues Its Expansion to a LEED Certified Building in De Pere, Wisconsin
3. Building quantum states with individual silicon atoms
4. New type of solar structure cools buildings in full sunlight
5. Designing interlocking building blocks to create complex tissues
6. Quantum devices: Building an innovative future for Canada
7. Researchers create building block of quanutm networks
8. Building better structural materials
9. HealthTech Capital Announces Awards for the HealthTech Conference 2012 - Building a Business in the New HealthTech Ecosystem
10. Building Wireless Solution More Important than Ever with New Tablets
11. New Study Building Framework to Bring Personalized Medicine to the Clinic
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Building 'invisible' materials with light
(Date:6/30/2015)... SAN DIEGO , June 30, 2015 /PRNewswire/ ... Continuing Education in Biosciences (CCE/Bio) and UC San ... microbial fermentation, to be held Aug.  12 – ... agenda ).  This three-day workshop provides an intense ... in industrial biotechnology, and is well-suited to biologists, ...
(Date:6/30/2015)... VANCOUVER , June 30, 2015 /PRNewswire/ - ... a clinical stage regenerative medicine company focused on ... the first participant in its Phase 1/2 clinical ... of chronic unilateral Achilles tendinosis, has been enrolled ... to intra-tendon ultrasound-guided injections. RCT-01 is comprised of ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... has accepted the position of vice president of instruction at Chippewa Valley Technical ... “I greatly appreciated the opportunity to lead SIUE during the past three years,” ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... launched “Cannavoices,” an unprecedented digital video and broadcast initiative. Produced by filmmakers, the ... dynamic collection of legal medical cannabis stories ever assembled. , Cannavoices profiles ...
Breaking Biology Technology:UC San Diego Extension to Offer Third Annual Microbial Fermentation Workshop 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 3RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 4SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 2SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 3Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3
... Senior Management Form Company ... and Podiatry Markets, FAIRFIELD, N.J., May 13 ... newly-formed,Company, led by the founder and the key Senior ... ), will develop, license and,commercialize innovative prescription products for ...
... with CelVida Yields First Milestone, NEW YORK, May ... pioneering the pre-disease collection, processing and long-term,storage of adult ... a,site has been secured for a new stem cell ... Robin Smith, MD MBA, NeoStem,s Chairman and Chief ...
... Pte Ltd today announced that,the U.S. Food and ... SB1518, its potent and orally-active JAK2 inhibitor for ... S*BIO,s,application upon review of preclinical data which demonstrated ... of the JAK2 inhibitor., "We are pleased ...
Cached Biology Technology:Medimetriks Pharmaceuticals, Inc. Begins Operations 2NeoStem to Expand Stem Cell Collection Center Network to Florida 2NeoStem to Expand Stem Cell Collection Center Network to Florida 3S*BIO Receives Orphan Drug Designation for JAK2 Inhibitor SB1518 for the Treatment of Myeloproliferative Disorders 2
(Date:6/24/2015)... 2015 Biometry authentication provider KeyLemon today ... solution one face in. Logo ... face in, entering the expanding biometric authentication market ... biometric answer to the password problem. With advanced ... with KeyLemon, one face in allows users to ...
(Date:6/23/2015)... GARDENS, Fla. , June 23, 2015 ... identity management and authentication solutions, today announced enhanced ... strong, multi-factor authentication solution.  The enhancements build ... use of the DigitalPersona Altus platform and ... reader compatibility. In today,s environment ...
(Date:6/17/2015)... , and HILDEN, Germany , June ... QGEN ; Frankfurt Prime Standard: QIA) today launched new Investigator ... in forensic laboratories in the United States ... to simultaneously analyze multiple key genomic markers (short tandem repeats ... Quality Sensor to evaluate the quality of DNA in ...
Breaking Biology News(10 mins):KeyLemon Announces Partnership With Biometric Password Solution onefacein 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5
... fewer television advertisements for certain foods, including those for ... to a report posted online today that will appear ... Pediatrics & Adolescent Medicine , one of the JAMA/Archives ... racial gaps in exposure to all food advertising have ...
... Saber-toothed cats may be best known for their supersized canines, ... before delivering the fatal bite, says a new study in ... "saber-toothed tiger," the extinct cat Smilodon fatalis roamed ... large mammals such as bison, camels, mastodons and mammoths. Telltale ...
... worry about the effects of air pollution on their health ... and fine particles in the air during pregnancy does not ... -- a serious condition that arises only during pregnancy -- ... at Buffalo epidemiologist. , The research was conducted in ...
Cached Biology News:Kids now see fewer television ads for sweets and beverages, but more for fast food 2Why you should never arm wrestle a saber-toothed tiger 2Air pollution doesn't increase risk of preeclampsia, early delivery, study finds 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: