Navigation Links
Boston Scientific Statement on the Passing of Senator Edward Kennedy
Date:8/26/2009

NATICK, Mass., Aug. 26 /PRNewswire/ --

The statement below is from Pete Nicholas, Chairman of the Board of Boston Scientific Corporation, on behalf of the Company, its employees and its Board of Directors.

Senator Kennedy leaves a legacy of unprecedented accomplishment across a remarkably broad spectrum of issues. Foremost among them was his long and productive work on health care, a cause we shared with him.

He was a tireless advocate for patients' rights and for access to quality health care for all. Over the past half century, he was involved in the passage of virtually every piece of major health care legislation, from Medicare in the 1960s to the recent children's health insurance bill.

We were fortunate to have Senator Kennedy visit our facilities to learn about our products and technologies and to thank our employees for all they do to improve patients' lives.

We are profoundly grateful for the opportunity to have known him, to have worked with him and to have been inspired by him.

Our tribute - and pledge - to Senator Kennedy is to continue working relentlessly on behalf of patients, many of whom saw him as their most dedicated champion and for whom medical innovation offers the greatest hope for restored health.

We will miss Senator Kennedy very much.

We extend our deepest sympathies to his family.

Boston Scientific is a worldwide developer, manufacturer and marketer of medical devices whose products are used in a broad range of interventional medical specialties. For more information, please visit: www.bostonscientific.com.

    CONTACT: Paul Donovan
             508-650-8541 (office)
             508-667-5165 (mob
'/>"/>
SOURCE Boston Scientific Corporation
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Boston Scientific to Webcast Conference Call Discussing Results of Landmark MADIT-CRT Trial
2. Boston University Periodontal Study on Imagenetix Compound Published in The Journal of Periodontology
3. Boston Scientific Announces European Approval for Its LATITUDE(R) Patient Management System
4. Boston Scientific to Participate in Wachovia Conference
5. Boston Scientifics SpyGlass(R) Direct Visualization System Featured in Broad Range of Clinical Studies at Upcoming Digestive Disease Week(R)
6. FDA Clears Boston Scientifics SpyScope(R) Access and Delivery Catheter for Use in Endoscopic Procedures Throughout Pancreatico-Biliary System
7. FDA Approves Boston Scientifics Next-Generation TAXUS(R) Liberte(R) Atom(TM) Stent System
8. Angiotechs corporate partner, Boston Scientific, announces launch of third-generation TAXUS(R) Element(TM) Stent
9. Boston Scientific Welcomes Launch of Syntax Score Website
10. Fate Therapeutics Granted Exclusive License for Stem Cell Modulators by Childrens Hospital Boston and Massachusetts General Hospital
11. Boston Scientific to Donate Cardiac Rhythm Management Devices to Heartbeat International for Implantation in Needy Patients
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: