Navigation Links
Biochemist and Geneticist Ronald W. Davis Receives $500,000 Gruber Genetics Prize for Pioneering Work in the Development of Biotechnologies that Have Significantly Advanced the Fields of Molecular Genetics and Genomics
Date:6/8/2011

NEW YORK, June 8, 2011 /PRNewswire/ -- Ronald W. Davis, PhD, a pioneer in innovative biotechnologies, particularly the development and practical application of recombinant DNA and genomic methods to biological organisms, will receive the 2011 Genetics Prize of The Peter and Patricia Gruber Foundation.

Davis, 69, has spent most of his professional life at Stanford University, where he is a professor of biochemistry and genetics. He also serves as director of the Stanford Genome Technology Center, a position he has held since 1994.

He will receive the award on October 13 in Montreal, during the annual meeting of the American Society of Human Genetics, which is being held in conjunction with the 12th International Congress of Human Genetics.  Davis will also deliver a lecture at the conference.

"Ron Davis' innovations have resulted in remarkable advances in modern molecular genetics. I am delighted that he is the 2011 Gruber Genetics Prize recipient," says Gruber and Nobel laureate Elizabeth Blackburn, the Morris Herzstein Professor of Biology and Physiology in the Department of Biochemistry and Biophysics at the University of California, San Francisco.

Davis' impact on biomedical research has been broad and profound. In 1968, while still a graduate student at the California Institute of Technology, he developed one of the first mapping methods for DNA, as well as heteroduplex technology, which made imaging the pairing of two genomes possible. After he moved to Stanford in 1972, Davis created some of the earliest cloning vectors - DNA molecules that carry foreign DNA into a host cell, where the foreign DNA can then be replicated.

A string of other technologies and discoveries quickly followed. Working on the genome and biology of Saccaharomyces cerevisiae (baker's yeast), Davis' lab developed the first artificially constructed chromosomes, which are now routinely used to clone large genes and to map complex ge
'/>"/>

SOURCE The Peter and Patricia Gruber Foundation
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. From GED to PhD: Borough of Manhattan Community Colleges Brian Olson Faces Academic Deficits Only to Be Rewarded with Acceptance to CUNYs PhD Program in Biochemistry
2. American Society for Biochemistry and Molecular Biology Reacts to District Court Stem-Cell Ruling
3. Mathematics and Biochemistry Research Earn Top Prize at Nations Premier High School Science Competition
4. Update: Georgia and North Carolina Teens Honored for Research in Biochemistry and Genetics in Nations Premier High School Science Competition
5. Max Planck Institute of Biochemistry Uses MathWorks Tools in Its Quest to Cure Cancer : Institute Accelerates Reconstruction of Key Protein Complexes Using MATLAB and Parallel Computing Toolbox
6. Mindray Appoints Mr. Ronald Ede as Chief Financial Officer
7. AMT CEO Ronald Lorijn Steps Down
8. [video] Ronald Andrews, CEO of Clarient, Inc. Discusses Agreement With University of Pennsylvania School of Medicine on WallSt.nets 3-Minute Press Show
9. Governor Gray Davis Joins Genesis Biopharma as Chairman of Corporate Advisory Board
10. Jack Davis, Diagnostics Industry Executive, Joins the HistoRx Board of Directors
11. Davis Phinney Foundation Launches Exercise-Focused Tools to Help People Live Well With Parkinsons Disease
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: