Navigation Links
BioStorage Technologies, Inc. to Hold Global Sample Management Benchmarking Symposium in Conjunction With 2011 IIR Biorepositories Conference
Date:9/7/2011

ctices in the Management of Patient Informed Consent"
  • Steve Sweeney, Head of Clinical Technologies, Infinity Pharmaceuticals, Inc.
    "Strategies for Improving the Onsite Management of Scientific Sample Assets"
  • Suzanne M. O'Shea, Legal Counsel, Baker and Daniels LLP and former Regulatory Counsel to the U.S. Food and Drug Administration
    "Understanding How to Navigate the Regulatory Environment When Managing Samples in China"

    • BioStorage Technologies is also a platinum sponsor of the Biorepositories Conference, and will host several workshops at the event. Lori Ball, Chief Operating Officer, BioStorage Technologies, will co-present a workshop titled, "Manage your Biorepository to Guarantee Full Life-Cycle Specimen Quality" and Catherine Michael, Sr. Director, Comprehensive Solutions, BioStorage Technologies, will give a presentation titled, "Incorporate Quality-Control Methodologies to Identify, Control, and Eliminate Threats to Specimen Longevity and Stability."

    For more information on the Global Sample Management Benchmarking Symposium, visit www.biostorage.com.

    About BioStorage Technologies, Inc.:

    BioStorage Technologies, Inc. is the premier, global provider of comprehensive sample management solutions for the bioscience industry. Offering onsite or outsourced management of sample assets, BioStorage Technologies manages the complete life-cycle of samples. With a team of global sample experts, state-of-the-art temperature-controlled storage facilities, and a real-time, web-based sample intelligence and tracking system, the company supports customers in maximizing opportunities, minimizing risk and reducing the cost of sample management. BioStorage Technologies, Inc. is privately held and headquartered in Indianapolis with an additional full-service site near Frankfurt, Germany. For more information, visit

    SOURCE BioStorage Technologies, Inc.
    Copyright©2010 PR Newswire.
    All rights reserved

    0

    GOOD

    Page: 1 2 3

    Related biology technology :

    1. BioStorage Technologies Showcases First-Ever Mobile Biorepository - Relofleet™ at Drug Information Association Annual Meeting
    2. BioStorage Technologies Expands U.S. Operations with Opening of New Biorepository Facility
    3. BioStorage Technologies Appoints New Director of Business Development for European Operations
    4. AMDeCs Vendor Program Expands Focus with Addition of BioStorage Technologies, Offering Preferred Pricing on Tissue Storage and Cold Chain Logistics Services
    5. BioStorage Technologies to Host Global Sample Management Benchmarking Symposium in Conjunction with Biorepositories Asia Conference
    6. BioStorage Technologies Introduces New Version of Web-based Tracking and Sample Management System - ISISS®
    7. BioStorage Technologies Appoints New Vice President of Global Sales
    8. BioStorage Technologies Brings Together Industry Leaders for Global Sample Management Benchmarking Symposium
    9. BioStorage Technologies, Inc., Welcomes Catherine Michael as Global Head of Sample Management Operations
    10. BioStorage Technologies, Inc., Appoints Jeff Goddard to Global Head of Sales
    11. BioStorage Technologies Takes Lead Sponsorship Role of 2nd Annual IIR Biorepositories Conference
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
    (Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
    (Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
    (Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
    Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
    ... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
    ... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
    ... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
    Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
    (Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
    (Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
    (Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
    Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
    ... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
    ... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
    ... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
    Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
    ... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
    Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
    Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
    Rabbit polyclonal antibody to GluR2...
    Biology Products: