Navigation Links
BioMarin Announces Third Quarter 2008 Financial Results
Date:10/28/2008

Well-Positioned for Continued Long-Term Growth Conference Call and Webcast to Be Held Today at 5:00 p.m. ET (22:00 CET)
NOVATO, Calif., Oct. 28 /PRNewswire-FirstCall/ --

Financial Highlights ($ in millions, except per share data)

Item Q3 2008 Q3 2007 Comparison

Total BioMarin Revenue $72.6 190.5% increase

Naglazyme Net

Product Revenue $33.3 56.3% increase

Aldurazyme Net Sales

by Genzyme $38.2 18.3% increase

Aldurazyme BioMarin

Net Product Revenue $20.7 NA

Kuvan Net Product

Revenue $13.8 NA

GAAP Net Income (Loss) $0.8, $0.01 per share ($5.2), ($0.05) per share

Non-GAAP Net Income

(Loss) $8.2, $0.08 per share ($0.2), ($0.00) per share

2008 Guidance Unchanged ($ in millions)

Item Guidance

Total BioMarin Revenues* $288 to $326

Total Net Product Revenues $247 to $285

Naglazyme Net Product Revenue $130 to $140

Aldurazyme Net Product Sales by Genzyme $135 to $145

Aldurazyme Net Product Revenue to BioMarin $72 to $80

Kuvan Net Product Revenue $45 to $65

Net Income (GAAP)* $30 to $42

Net Income (non-GAAP)* $54 to $69

*Assumes that the $30 million milestone for EU Kuvan approval will be earned in 2008

BioMarin Pharmaceutical Inc. (Nasdaq: BMRN) today announced financial results for the third quarter ended Septembe
'/>"/>

SOURCE BioMarin Pharmaceutical Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12

Related biology technology :

1. BioMarin Corrects Information Included in Bloomberg Article
2. BioMarin to Present at the Merrill Lynch Global Pharmaceutical Conference
3. BioMarin to Present at the Morgan Stanley Global Healthcare Conference
4. BioMarin to Present at the Citi Biotech Day
5. BioMarin Announces Roll-Out of National PKU Registry
6. BioMarin to Host Second Quarter 2008 Financial Results Conference Call and Webcast on Tuesday, August 5 at 5:00 p.m. ET (23:00 CET)
7. BioMarin to Present at the Collins Stewart Growth Conference
8. SciQuest Announces Newest Life Sciences Customer; BioMarin Pharmaceutical Drives Spending Effectiveness with Automated, Intuitive Procurement
9. BioMarin Announces Program for ERT for Treatment of MPS IVA - Morquio A Syndrome
10. BioMarin to Host Research and Development Day June 5th
11. BioMarin to Present at the Bank of America Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: