Navigation Links
Binex and MaxCyte Collaborate on Cancer Immunotherapy Research
Date:11/30/2007

BUSAN, South Korea and GAITHERSBURG, Md., Nov. 30 /PRNewswire/ -- Binex (KOSDAQ: 053030) and MaxCyte, Inc. announced today the signing of a Sponsored Research Agreement to evaluate MaxCyte's GMP-compliant cell loading technology for use in closed-system manufacturing of Binex's cell-based cancer immunotherapies. Upon completion of the research studies, the agreement provides Binex an option to license MaxCyte's technology for clinical and commercial use in Korea. Financial terms were not disclosed.

"Based upon its impressive capabilities, we believe MaxCyte's cell loading technology can be an important component of our closed system," said Baek Chun Lee, Ph.D., Binex's Chairman. "Our immunotherapy product is currently undergoing review by the Korean FDA for colorectal and non-small cell lung cancers and clinical studies are in progress for breast and gastrointestinal cancers. We expect cell immunotherapies to continue to be a core business for Binex. As we advance this therapy, we are developing a closed system manufacturing process which will allow us to improve scalability and reduce cost for making inroads into world markets. We believe MaxCyte's technology can contribute significantly as we expand this product toward new indications."

"We are extremely pleased to be working with Binex to advance their promising cancer vaccine. Our technology has been shown to be uniquely effective, capable of producing cell-based therapeutics that are highly reproducible, with the scalability and efficiency needed for commercial use," said Douglas Doerfler, President and CEO of MaxCyte. "Binex's readiness to partner with MaxCyte validates both the enablement of our cell loading technology platform and their leadership as a life sciences company."

About Binex

Binex Co., Ltd. is a publicly traded specialized pharmaceutical company located in Busan, Korea developing a broad range of pharmaceutical products such as nutrients and vitamin com
'/>"/>

SOURCE MaxCyte, Inc.
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Medinet Licenses MaxCyte Cell Loading Technology for Cancer Immunotherapy in Japan
2. KineMed to Collaborate With Merck KgaA to Validate New Applications for Drug Development Candidates
3. Rice, Nanyang Tech collaborate on sustainable nanoelectronics
4. NYU Medical Center Collaborates With Rosetta Genomics to Develop a microRNA-Based Diagnostic Test for Melanoma
5. GeneGo and the Cystic Fibrosis Foundation Collaborate to Advance Understanding of Cystic Fibrosis
6. Monsanto and Evogene Collaborate on Nitrogen Use Efficiency Research
7. Project on Emerging Nanotechnologies and Consumers Union collaborate on ConsumersTalkNano
8. New Pharmacogenomic Approach: 454 Life Sciences and Perlegen to Collaborate in Drug Response Sequencing Study
9. Astellas Pharma US, Inc. and The International Transplant Nurses Society (ITNS) Collaborate on Content for Transplant Experience Program
10. Genzyme and Sunway to Collaborate on Gene Therapy Program in China
11. Dendreon Announces Publication of Phase 1 Study Highlighting Immunologic and Clinical Activity of Lapuleucel-T (Neuvenge(R)) in Advanced Breast Cancer Patients
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/15/2014)... DTS Language Services, Inc . is ... for Life Science organizations who need document translations. Clients ... of their documents in advance with a selection of nearly ... translations, often a critical factor in clinical and scientific fields, ...
(Date:1/14/2014)... Doylestown, PA (PRWEB) January 14, 2014 Date: ... p.m. , Location: Warrington Country Club, 1360 Almshouse Road, Warrington, ... only national nonprofit organization solely dedicated to finding a cure ... those affected worldwide, will host its annual Crystal Ball on ...
(Date:1/14/2014)... (PRWEB) January 14, 2014 EquitiesIQ, a ... Inc. (OTCQB: ALQA). Alliqua is an emerging biomedical company ... the wound care market. , Free report download: ... with a seasoned management team and Board, which launched ...
(Date:1/14/2014)... Jan. 14, 2014  RXi Pharmaceuticals Corporation (OTCQX: RXII), ... commercializing innovative therapies addressing major unmet medical needs ... the Notice of Allowance from the United States ... RNAi compounds (sd-rxRNA®), for the treatment of fibrosis. ...
Breaking Biology Technology:DTS Improves Efficiency for Life Science Document Translations 2Hepatitis B Foundation to Host Annual Crystal Ball Gala 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 2RXi Pharmaceuticals Receives US Notice of Allowance for a Key Patent Relating to its Self-Delivering Technology with sd-rxRNAs targeting CTGF, including RXI-109, for the Treatment of Fibrotic Disorders 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... fruit flies eat like horses. Hatching inside over-ripe fruit where they ... sends them an offer they cant refuse. To survive, they must ... they avoid food as if it were poison. Only then can ... to lay their own eggs. Now, a team of researchers ...
... migration to EAC ePassport technology, DALLAS, May ... (Nasdaq: ENTU ) will provide its proven ... authenticate sensitive,biometric information stored on machine readable travel ... will be available to nearly 23 million,citizens by ...
... Board: BKYI) today announced plans to release first quarter,2008 financial ... conjunction with the release, BIO-key has scheduled a conference call,which ... 15, 2008 at,9:00 a.m. Eastern Time., What: ... Call ...
Cached Biology News:Fruit fly avoidance mechanism could lead to new ways to control pain in humans 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 2Entrust, Hewlett Packard Partner to Deploy Taiwanese ePassports, Authenticate Biometric Data 3BIO-key(R) Announces First Quarter 2008 Earnings Release and Conference Call Schedule 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: