Navigation Links
Bayer CropScience Charts Course For Cultivating Bee Health Solutions With Opening Of Clayton Bee Care Facility
Date:11/18/2013

commitment/bayer-initiatives. You can also follow and share with us on Twitter at @BayerBeeCare, on Facebook at facebook.com/BayerBeeCareCenter and view photos on Flickr.

Bayer CropScience is committed to bringing new technology and solutions for agriculture and non-agricultural uses. For questions concerning the availability and use of products, contact a local Bayer CropScience representative, or visit Bayer CropScience online at bayercropscience.us.

###

About Bayer CropScience
Bayer is a global enterprise with core competencies in the fields of health care,
agriculture and high-tech materials. This year the company looks back on 150 years of working to fulfill its mission “Bayer: Science For A Better Life”. Bayer CropScience, the subgroup of Bayer AG responsible for the agricultural business, has annual sales of EUR 8,383 million (2012) and is one of the world’s leading innovative crop science companies in the areas of seeds, crop protection and non-agricultural pest control. The company offers an outstanding range of products including high value seeds, innovative crop protection solutions based on chemical and biological modes of action as well as an extensive service backup for modern, sustainable agriculture. In the area of non-agricultural applications, Bayer CropScience has a broad portfolio of products and services to control pests from home and garden to forestry applications. The company has a global workforce of 20,800 and is represented in more than 120 countries. This and further news is available at: press.bayercropscience.com.

Contact:
Bayer CropScience Media Hotline, 1-877-879-6162, or

Bet
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Bayer CropScience Discusses Sustainable Innovations in Food Security at Washington, D.C. Summit
2. Bayer CropScience Introduces Specticle plus Fertilizer
3. Bayer CropScience Debuts Serenade Optimum to Help Growers Control Tough Diseases and Combat Resistance
4. Bayer CropScience Supports 10th Anniversary of United Way Of The Greater Triangle’s Girls’ Leadership Development Initiative
5. Bayer CropScience and the Florida Specialty Crop Foundation Join Together to Fight Citrus Greening
6. Bayer CropScience Adds Three New HBK Seed Varieties for 2014
7. Bayer CropScience Looks to the Future of Farming at 2013 Farm Progress Show
8. Bayer CropScience Commits to Future of Illinois Agriculture, Education and Communities
9. Bayer CropScience and MS Technologies Receive Approval for Balance GT Soybean Technology in the United States
10. Bayer CropScience Adds New Canola Hybrids and Traits
11. American Museum of Agriculture Changes Name to Reflect Bayer CropScience’s Agriculture Tradition and World-Class Technology
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... , , , , , , ... , 1Thermo Finnigan, Piscataway, NJ; , ... , Chemical Structure Validation , ... of ion trap mass spectrometers , , ...
... , , , , , , David Barnidge ... , Neuromics, Inc., Minneapolis, MN , ... , ICAT Analysis , , , ... ProteomeX integrated proteomics workstation., , , , , , ...
... , , , , , ... Center for Neurologic Diseases, Brigham and Womens Hospital, Harvard , ... , , , Genetic manipulations using neuronal cells ... RNA (siRNA) , to primary neuronal cultures is of critical ...
Cached Biology Technology:Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 2Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 3Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 4Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 5Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 6Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 7Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 8Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 9Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 2Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 3Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 4Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 5Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 6Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 7Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 2Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 3Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 4Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 5
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance ... technology to industry leaders such as Intel, Jabra, Atlas, ... biometric wearable products. These products will be showcased at ... Las Vegas . "Our partners ... and robust – with the clinical data to back ...
(Date:12/11/2014)... --Research and Markets , ... ) has announced the addition of the ... their offering. One major trend ... multimodal biometric systems. Multimodal biometric systems utilize more ... and identification purposes. This helps to reduce the ...
(Date:12/10/2014)... , Dec. 9, 2014  Wake Forest Baptist Medical ... building for its School of Medicine. Funding for this ... capital campaign that will be publicly launched next summer. ... located in the former 60 series R.J. Reynolds Tobacco ... Quarter. Construction will begin immediately with plans to be ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4
... conducted by researchers at The University of Texas School ... abuse and dependence among Hispanic male populations in the ... along the U.S.-Mexico border. The expansion is supported ... on Alcohol Abuse and Alcoholism of the National Institutes ...
... book Artificial Gravity , edited by Gilles Clment and ... from the International Academy of Astronautics. This award is given ... the Academy in the fields related to life science. The ... on 28 September 2008 in Glasgow, Scotland. Artificial ...
... 2008) Just three years after it was discovered, a ... the Wildlife Conservation Society, which recently published the first-ever census ... the large, forest-dwelling primate hovers at 1,117 individuals, according to ... Oryx . The population estimate was the ...
Cached Biology News:Survey of Hispanics and alcohol dependence 2
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: