Navigation Links
Bavarian Nordic Update - 2007 Annual Results, IMVAMUNE(R) Delivery Contract, Strategy Process
Date:4/2/2008

Furthermore, Bavarian Nordic has appointed a new CFO. Ole Larsen (42) will join the company as Executive Vice President Finance on 1 October 2008 at the latest. He currently holds the position as Finance Director and member of the management in Nordisk Film. Previously amongst others he worked as Finance Director at Berlingske Tidende.

Reiner Laus, MD., President & CEO of Bavarian Nordic's US subsidiary, BN ImmunoTherapeutics Inc., will also join the Executive Management. Reiner Laus was previously Vice President of Research and Development at Dendreon Corporation in Seattle, Washington where he was responsible for discovery, pre-clinical and development functions.
Executive Management hereafter consists of the following:

Anders Hedegaard, President & CEO

Nicolai Buhl Andersen, EVP Commercial Affairs

Paul Chaplin, EVP Research & Development

Reiner Laus, EVP, and CEO of BN ImmunoTherapeutics Inc.

Morten Max Rasmussen, EVP Transactions, Legal & IPR

Anders Gram, EVP Technical Operations

Ole Larsen, EVP Finance

Annual Report 2007 The full 2007 Annual Report was published on March 31, 2008 and is available for download on the company's website: http://www.bavarian-nordic.com

About Bavarian Nordic:

Bavarian Nordic, headquartered in Denmark, is a leading international biopharmaceutical company developing and producing innovative vaccines to prevent and treat infectious diseases and cancer.

In the U.S., Bavarian Nordic operates subsidiary companies, BN ImmunoTherapeutics, in Mountain View, California developing vaccines against cancers, and Bavarian Nordic Inc. in Washington, D.C. focused on business development, marketing, and government relations for the Bavarian Nordic Group.

For more information on Bavarian Nordic visit: http://www.bavarian-nordic.com


'/>"/>

SOURCE Bavarian Nordic A/S
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9

Related biology technology :

1. Bavarian Nordic Receives $50 Million Advance Payment from HHS for Fulfilling Contract Milestones
2. Vista Partners Updates Coverage; Maintains $3.20 Target Price
3. ImaRx Therapeutics Reports Business Update and Financial Results for Fourth Quarter and Full Year 2007
4. NanoLogix Inc. Presents at the National Hydrogen Association Conference & Provides Operations, Management and Director Update
5. SGX Pharmaceuticals Provides Update on SGX523 Clinical Trials
6. ImaRx Reschedules Release of Corporate Updates and Fourth Quarter and Full Year 2007 Financial Results
7. ImaRx to Report Corporate Updates and 4Q07 Financial Results
8. LUMEDX Updates Real-Time Patient and Resource Scheduler for Healthcare Systems
9. InfuSystem Holdings Provides Business Update and Comments on Fourth Quarter 2007 Financial Results
10. Alexza to Announce 2007 Financial Results and Update Its Clinical Pipeline on Monday, March 17, 2008
11. Halozyme Therapeutics to Hold Pipeline Update Conference Call on March 14
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: