Navigation Links
Awareness of Omega-3 Benefits Soars
Date:7/26/2012

ST. LOUIS, July 26, 2012 /PRNewswire/ -- More Americans than ever consider omega-3s "healthy." The number of consumers who perceive omega-3 as a healthy fatty acid rose five points to 84 percent, according to the United Soybean Board's (USB) 19th annual Consumer Attitudes about Nutrition survey (vs. 79 percent in 2011). "Omega-3 continues to be the only fat consumers perceive as more healthy than unhealthy," says Lisa Kelly, MPH, RD, for the United Soybean Board.

(Photo: http://photos.prnewswire.com/prnh/20120726/SF45932)

While fish oil is the preferred source of omega-3s because of the bioavailability of eicosapentaenoic (EPA) and docosahexaenoic acid (DHA), the alpha-linolenic acid (ALA) in soybean oil is one of the few non-fish sources and the principal source of omega-3s in the American diet. The American Heart Association says consumers should get ALA from sources such as soybean oils. Relatively low in saturated fat and containing zero grams trans fat, soybean oil is also the primary commercial source of vitamin E, a natural antioxidant against a number of cancers, heart disease, cataracts, premature aging and arthritis.

"With Americans not consuming as much fish as dietitians would like, soybean oil has always been the primary source of omega-3s in their diet, but it is a less bioavailable omega-3 (ALA)," notes Kelly. She adds, "What's really exciting to me is that soybeans producing an excellent source of omega-3s (primarily EPA) are about to hit the marketplace."

Soybean Oil Turns Heads – Consumers Say about Vegetable Oil, "Label It!"

Awareness that most vegetable oil is de
'/>"/>

SOURCE United Soybean Board
Copyright©2012 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. BioStorage Technologies Partners with Susan G. Komen for the Cure Tissue Bank at IU Simon Cancer Center to Raise Money and Awareness for Breast Cancer Research
2. EveryDayMatters.com Aims to Raise Awareness and Coordinate Care Between Mental and Physical Health
3. European Multiple Sclerosis Market in Dire Need of Increased Disease Awareness and Treatment Options, Cautions Frost & Sullivan
4. Charlie Wilson Teams Up With Janssen Biotech to Launch Making Awareness a Priority (M.A.P.)
5. Preeclampsia Awareness Month Marked By Promise Walks in 36 Cities
6. Shire Facebook Page Increases Awareness of Hereditary Angioedema (HAE) in Support of First HAE Awareness Day May 16th
7. Covenant Security Services and the Department of Homeland Security Partner to Provide Nationwide Training on Active Shooter Awareness and Response
8. July is not just about BBQ's; the Arthritis National Research Foundation honors Juvenile Arthritis Awareness Month
9. Little known pregnancy disease, Hyperemesis Gravidarum, receives awareness with a $20,000 donation from the H.E.R. Foundation to begin Genome Research at UCLA
10. New biosensor benefits from melding of carbon nanotubes, DNA
11. New research points to benefits of innovative cobas® HPV test for primary screening as Englands cervical cancer screening programme includes the test in current HPV "triage" rollout
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: