Navigation Links
Auxilium Pharmaceuticals, Inc. Announces Fourth Quarter and Full Year 2012 Financial Results and Guidance for 2013
Date:2/26/2013

ures.  Auxilium management will use these non-GAAP financial measures to monitor and evaluate our operating results and trends on an ongoing basis and internally for operating, budgeting and financial planning purposes.  Auxilium management believes the non-GAAP information will be useful for investors by offering them the ability to better identify trends in our business and better understand how management evaluates the business.  These non-GAAP financial measures that management will use will be presented in addition to results prepared in accordance with GAAP and should not be relied upon as an alternative to GAAP financial measures.  We currently anticipate that non-GAAP operating expenses and net income for 2013 will exclude stock-based employee compensation expense and imputed interest related to the convertible senior notes due in 2018.For 2013, Auxilium anticipates that:

  • Global net revenues will be in the range of $325 to $355 million;
  • Global Testim net revenues will be in the range of $250 to $265 million;
  • U.S. XIAFLEX net revenues will be in the range of $65 to $75 million; 
  • Ex-U.S. and deferred revenues for XIAFLEX will be in the range of $10 to $15 million;
  • Research and development spending on a non-GAAP basis will be in the range of $45 to $55 million;
  • Selling, general and administrative expenses on a non-GAAP basis will be in the range of $185 to $195 million;
  • Net interest expense on a non-GAAP basis will be in the range of $3 to 4 million; and, 
  • Net income on a non-GAAP basis will be in the range of $18 to $23 million.
  • Research and development and Selling, general and administrative expenses referred to above for 2013 exclude approximately $3 and $13 million, respectively, of estimated costs related to employee stock based compensation.  The Company excludes these costs because they constitute non-cash expenditures that are de
    '/>"/>

    SOURCE Auxilium Pharmaceuticals, Inc.
    Copyright©2012 PR Newswire.
    All rights reserved

    Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14

    Related biology technology :

    1. Auxilium Announces Appointments to Enhance Leadership Team
    2. Auxilium Pharmaceuticals, Inc. to Present at the Jefferies 2012 Global Healthcare Conference
    3. Auxilium Pharmaceuticals, Inc. to Present At The JMP Securities 2012 Healthcare Conference
    4. Auxilium Pharmaceuticals, Inc. to Present at the Canaccord Genuity 32nd Annual Growth Conference
    5. Auxilium Pharmaceuticals, Inc. to Present At The Oppenheimer 23rd Annual Growth Conference
    6. Auxilium Pharmaceuticals to Announce Fourth Quarter and Full Year 2012 Results and Conduct Conference Call on Tuesday, February 26, 2013
    7. Auxilium Pharmaceuticals, Inc. to Present at the Leerink Swann Global Healthcare Conference
    8. Keryx Biopharmaceuticals, Inc. Announces Upcoming Poster Presentations of Zerenex™ (Ferric Citrate) at the Upcoming American Society of Nephrology Kidney Week 2011 Annual Meeting
    9. Synergy Pharmaceuticals, Inc. Files Suit Against Ironwood Pharmaceuticals, Inc. and its Chief Scientific Officer and Senior VP of R&D, Dr. Mark G. Currie
    10. Silence Therapeutics Partner, Quark Pharmaceuticals, Extends its Agreement With Pfizer to Develop one of Its Compounds Containing Silences AtuRNAi in a New Indication
    11. MAP Pharmaceuticals, Inc. Announces Proposed Public Offering of Common Stock
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:5/21/2015)... 20, 2015 Research and Markets ... the "2015 Global Survey on Flow Cytometry ... The primary goal of this research is ... and reagents. Key information the survey seeks to ... flow cytometers, predominantly used applications for flow cytometers, ...
    (Date:5/21/2015)... 21, 2015 Veolia’s environmental monitoring ... North American distribution agreement with VWR to distribute ... With more than 160 years of experience, VWR, ... for laboratory and production facilities, has cultivated a ... differentiated services to enable science. Endetec’s TECTA™ ...
    (Date:5/20/2015)... FRANCISCO, Calif. , May 20, 2015 /PRNewswire/ ... ) today presented preliminary data demonstrating the ability ... idiopathic pulmonary fibrosis (IPF) from other interstitial lung ... findings suggest the classifier,s potential to help thousands ... to resolve ambiguity in IPF diagnosis – a ...
    (Date:5/20/2015)... 2015 This year has been one ... US Patented Pearl’s Premium Ultra Low Maintenance Lawn ... country that are coming out of record bad weather. ... of major global concerns related to water, health, and ... the alternative to the standard, water-wasting, chemical-treated standard lawn. ...
    Breaking Biology Technology:Global Survey on Flow Cytometry Adoption Trends 2015 2Veolia’s TECTA™ B16 Instrument for E. Coli Detection is Offered Exclusively Through VWR 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Breakthrough 4th Generation Low Maintenance Lawn Seed Offers Solution to California Drought 2
    ... England, November 26 Sosei,Group Corporation ("Sosei"; TSE Mothers ... out-licensed its IP and Know How,relating to the RS(+) ... based pharma company, for the treatment and prophylaxis of,malaria. ... a highly efficacious anti-malarial drug that is approved in,its ...
    ... 25 Beckman Coulter, Inc. (NYSE: BEC ), ... automate, and innovate complex biomedical testing, announced today that Paul ... will present at the following conferences: , ... , , ...
    ... COLUMBUS, Ohio, Nov. 25 CAS REGISTRY, the world,s ... million organic and inorganic substances. CAS Registry Number(R),1073662-18-6 recently ... (Photo: http://www.newscom.com/cgi-bin/prnh/20081125/CLTU095 ) ... http://www.newscom.com/cgi-bin/prnh/20070817/CLF008LOGO ) , ...
    Cached Biology Technology:Sosei Announces the Out-licensing of RS(+) Mefloquine to Treague Ltd for the Treatment and Prophylaxis of Malaria 2Beckman Coulter to Present at Upcoming Healthcare Conferences 2CAS Registers 40 Millionth Substance in CAS REGISTRY(SM) 2
    (Date:5/11/2015)... SAN JOSE, Calif. , May 11, 2015 ... leading developer of human interface solutions, today announced ... Senior Vice President and Chief Financial Officer, reporting ... Mr. Ali replaces Synaptics, current Chief Financial Officer, ... in December 2014. Mr. Ali ...
    (Date:5/8/2015)... -- Synaptics Inc. (NASDAQ: SYNA ), the leading developer ... executive management team will present at the following investor events: ... Conference Date: May 18, 2015 Time: 10:40am ET ... Cowen and Company Technology, Media & Telecom ... New York Palace Hotel, New York, NY ...
    (Date:4/27/2015)... -- For more than four decades, AUVSI,s Unmanned Systems ... worldwide event for the unmanned land, sea, and air ... any local, national, or trade news organization interested in ... current applications of unmanned technologies. The conference will explore ... industry, and how it will soon impact the lives ...
    Breaking Biology News(10 mins):Synaptics Appoints Wajid Ali as Senior Vice President and Chief Financial Officer 2Synaptics to Present at Upcoming Investor Conferences 2UNMANNED SYSTEMS 2015: Largest International Conference and Trade Show for the Drone and Unmanned Technology Industry 2UNMANNED SYSTEMS 2015: Largest International Conference and Trade Show for the Drone and Unmanned Technology Industry 3UNMANNED SYSTEMS 2015: Largest International Conference and Trade Show for the Drone and Unmanned Technology Industry 4UNMANNED SYSTEMS 2015: Largest International Conference and Trade Show for the Drone and Unmanned Technology Industry 5
    ... was published showing that silk produced by transgenically-engineered silkworms ... biological sciences at University of Notre Dame, exhibits the ... stronger silk could possibly be used to make sutures, ... in the Proceedings of the National Academy of ...
    ... insect,s internal chemicals can be converted to electricity, potentially providing ... a group of researchers at Case Western Reserve University report. ... from universities across the country that could bring the creation ... super spies out of science fiction and into reality. ...
    ... both the diagnosis and treatment of breast cancer, the ... a new imaging technology under investigation at the Biodesign ... subtle aberrations in cell nuclear structure, the molecular biosignature ... by providing early detection of the disease. The ...
    Cached Biology News:Hybrid silkworms spin stronger spider silk 2Implanted biofuel cell converts bug's chemistry into electricity 2Implanted biofuel cell converts bug's chemistry into electricity 3Cell-CT: A new dimension in breast cancer research 2Cell-CT: A new dimension in breast cancer research 3Cell-CT: A new dimension in breast cancer research 4
    ...
    ... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
    ... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
    ... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
    Biology Products: