Navigation Links
Auxilium Pharmaceuticals, Inc. Announces Fourth Quarter and Full Year 2010 Financial Results, Guidance for 2011
Date:2/10/2011

$45 million; and,
  • Total stock-based compensation recognized in 2011 will be in the range of $15 million to $20 million.

  • Auxilium will focus on the following strategic priorities in 2011:

  • Maximize XIAFLEX net revenues for Dupuytren's contracture in the U.S. and global Testim revenues;
  • Support Pfizer in the launch of Xiapex for Dupuytren's contracture in the EU;
  • Complete enrollment in the Peyronie's disease phase III double-blind studies in the first quarter of 2011, with top-line results anticipated in first half of 2012; and,
  • Advance XIAFLEX new indication(s).

  • Fourth Quarter 2010 Revenue DetailsAuxilium reported the following unaudited net revenues (all amounts in millions of dollars) for the quarter ended December 31, 2010: Quarter EndQuarter EndIncrease12/31/201012/31/2009 (Decrease)Testim U.S. Revenue

    $52.1$42.223%Testim Ex – U.S. & Contract Revenue

    1.34.9(74%)Total Testim Revenue

    $53.4$47.113%XIAFLEX U.S. Revenue

    $7.3-n/aXIAFLEX Contract Revenue

    1.10.922%Total XIAFLEX Revenue

    $8.4$0.9845%Total Worldwide Revenue

    $61.8$48.029%Contract Revenues represent amortization of previously received upfront and milestone payments.

    Fourth Quarter 2010 Financial Detail  The net loss for the fourth quarter of 2010 was $(16.4) million, or $(0.34) per share, compared to a net loss of $(11.9) million, or $(0.25) per share, reported for the fourth quarter of 2009.  Net loss for the fourth quarter of 2010 includes total stock-based compensation expense of $6.0 million, compared to $4.4 million for the fourth quarter of 2009.

    Gross margin on net revenues was 72% for the quarter ended December 31, 2010 compared to 78% for the comparable period in 2009.  Gross margin reflects the costs of products sold, royalty obligations due to the Company's licensors, the amortization of the deferred costs associated with the Pfizer con
    '/>"/>

    SOURCE Auxilium Pharmaceuticals, Inc.
    Copyright©2010 PR Newswire.
    All rights reserved

    Page: 1 2 3 4 5 6 7 8 9 10

    Related biology technology :

    1. Auxilium Pharmaceuticals to Announce Fourth Quarter and Full Year 2010 Results and Conduct Conference Call on Thursday, February 10, 2011
    2. Keryx Biopharmaceuticals, Inc. to Hold Conference Call on Second Quarter 2008 Financial Results on Monday, August 11, at 8:30 A.M. EDT
    3. VioQuest Pharmaceuticals, Inc Q2/08 Review Issued by Scimitar Equity, LLC
    4. Rib-X Pharmaceuticals, Inc. Announces Formation of Clinical Advisory Board
    5. Pacira Pharmaceuticals, Inc. Adds Experienced Physician Dr. David St. Peter to Leadership Team
    6. Transcept Pharmaceuticals, Inc. to Present at the Natixis Bleichroeder Second Annual Hidden Gems Conference
    7. Transdel Pharmaceuticals, Inc. Retains The Investor Relations Group
    8. Chemical Engineering Conference Highlights Energy, Biomedicine, Pharmaceuticals, Sustainability and Centennial
    9. Alseres Pharmaceuticals, Inc. Reports Third Quarter 2008 Operational and Financial Results
    10. Johnson & Johnson Completes Acquisition of Omrix Biopharmaceuticals, Inc.
    11. Alseres Pharmaceuticals, Inc. Announces $1 Million Financing
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
    (Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
    (Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
    (Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
    Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
    ... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
    ... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
    ... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
    Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
    (Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
    (Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
    (Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
    Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
    ... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
    ... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
    ... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
    Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
    Agarose II (Low Melt)...
    ... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
    Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
    Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
    Biology Products: