Navigation Links
Attagene's Breakthrough Transcription Factor Profiling Technology to be Described in Nature Methods
Date:2/25/2008

oach.

"A defining feature of FACTORIAL(TM) is that all reporter constructs have virtually identical reporter sequences and thus produce nearly identical messages," says Dr. Makarov. "These reporter messages are equally susceptible to broad variations in experimental and detection conditions, such as degradation, amplification, and thus their relative concentrations remain unaffected. From this homogeneity stems an amazing robustness and reproducibility of assessments."

Among many potential applications of FACTORIAL(TM), one of the most promising is drug evaluation and predictive toxicology. By observing alterations in transcription factors activities in response to drug candidates, one can immediately identify the involved pathways. By comparing signatures of evaluated drug candidates with databases of reference profiles, one can obtain invaluable information about drug candidate's mechanisms of action and potential side effects. In this regard, the FACTORIAL(TM) assay greatly synergizes with conventional system biology approaches, such as transcriptomics and proteomics. Akin to that, the FACTORIAL(TM) assay may prove invaluable for predicting toxic properties of environmental toxicants. This application has been validated as a part of the ToxCast program of the U.S. Environmental Protection Agency.

Currently, the prototypical FACTORIAL(TM) evaluates slightly more than 40 transcription factor families, but the system can be readily expanded by including additional reporters. Researchers believe that eventually they will be able to evaluate the entire complement of human transcription factors.

About Attagene

Attagene Inc. is biotechnological company founded in 2001 and located in the Research Triangle Park, North Carolina. Its mission is to accelerate drug discovery and development by providing innovative tools for examining signal transduction. Company's research team has scientists with academic and industrial background, with exp
'/>"/>

SOURCE Attagene Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Cephalon Announces Positive Results from a Pivotal Study of FENTORA in Opioid-tolerant Patients with Non-cancer Breakthrough Pain
2. NeoMatrix Announces Additional Funding for Breakthrough Breast Cancer Screening Test
3. Kingfisher Healthcare Launches Breakthrough Product in Europe
4. New technique can be breakthrough for early cancer diagnosis
5. Breakthrough research identifies how cells from pigs may cure diabetes
6. Harmonex Introduces CliniCom(TM), a Breakthrough in Psychiatric Intake and Assessment Technology
7. Medical Breakthrough ... Doctor Discovers Penetrating Carrier That Eradicates Fungus
8. H&V Introduces HVision Technology Platform to Accelerate Development of Breakthrough Products
9. Discovery Institute Bioethicist Lauds Breakthrough in Stem Cells Research that Eliminates Need for Human Cloning
10. Stem Cell Breakthrough Could End Human Embryonic Experimentation
11. Panacea Pharmaceuticals Lung Cancer Diagnostic Test, LC Detect(SM), Named One of Time Magazines Ten Biggest Medical Breakthroughs of 2007
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: