Navigation Links
Atlantic Peptides, a Synthetic Peptide Manufacturer, Unveils Its New Website for Easier Navigation

Scarborouth, Maine (PRWEB) November 05, 2013

Atlantic Peptides, a synthetic peptide manufacturer, unveils its new website for easier navigation.

Atlantic Peptides (, a synthetic peptide manufacturer and polyclonal and monoclonal antibody supplier, announces the launch of its new website. The updated site marks Atlantic Peptide’s initiative to reach an even broader national and international audience through the life-science and academia industries.

Atlantic Peptides announces the launch of its new website design, which facilitates easier user navigation. Atlantic Peptides is a synthetic peptide manufacturer and supplier of polyclonal and monoclonal antibodies to national and international academia and science industries. The Scarborough-based business also works with the pharmaceutical industries by supplying therapeutic initiatives with peptides for research studies.

The website features updated, in-depth coverage of the types of products Atlantic Peptides offers, such as custom peptides for the production of antibodies. As detailed by the new website, services also include the evaluation and analysis of peptides prior to synthesis by the use of hydrophobicity plots, evaluation of the stability and solubility of peptides, as well as the analysis of secondary structure formations, and more.

The site additionally houses an easy-to-use Peptide Library that serves as a useful resource, describing industry-relevant terms like overlapping peptide library, truncation peptide library, alanine peptide scanning library, and random peptide library for those interested in learning about term variations.

Atlantic Peptides is partnered with a United Kingdom company to provide cGMP services to support the various stages of clinical studies, from pre-clinical toxicology studies

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Atlantic Shores Retirement Community Develops Cutting-Edge Program for CCRC Patient Care
2. Keiretsu Forum Mid-Atlantic Launches July Four-City Road Show
3. MS Tûranor PlanetSolar Sets World Speed Record for Transatlantic Crossing by Solar Electric Vessel
4. Atlantic Peptides Teams Up with a United Kingdom Company to Offer cGMP Peptides and API
5. Atlantica Group LLC to Support International "Soft-Landing" Efforts of Incubators and Accelerators
6. Atlantica Group LLC to Support Global Business Incubation and "Soft Landing" Efforts
7. Air Products to Feature Medical and Industrial Grade Gas Solutions for Pharma, Biotech, and Life Science Applications at Mid-Atlantic Bio Conference
8. Human Genome Decoder and Artificial Life Creator, J. Craig Venter to Speak at "The Atlantic Meets the Pacific"
9. Lend Lease Announces the Appointment of Tom Chapman as Director Operations for the Life Sciences Group in the Atlantic Region
10. Waters Unveils Industrys First Integrated LC/MS Platform for Proteins, Peptides, and Glycans Analysis at WCBP 2013
11. Synthetic Biologics Responds to Recent CDC Report on Threat of "Super Bugs"
Post Your Comments:
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... /PRNewswire-Asia-FirstCall/ -- Genesis,Pharmaceuticals Enterprises, Inc. (OTC Bulletin ... pharmaceutical company with its principal operations in ... it engaged KPMG Huazhen,("KPMG"), a member firm ... firms,affiliated with KPMG International, to assist the ...
... & Company, LLC, a,Boston-based life science investment bank, ... joined the firm as senior advisor. In ... on internal and client-related activities including,merger & acquisition ... focus on biopharmaceutical transactions. "We are delighted ...
... PTNEW YORK, Jan. 13 Keryx Biopharmaceuticals, Inc. (Nasdaq: ... Weiss, the Company,s Chairman and Chief Executive Officer, is ... Healthcare Conference being held in San Francisco.Mr. Weiss, presentation ... 1:00pm PT and will be accessible from the Investor ...
Cached Biology Technology:Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 2Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 3Keryx Biopharmaceuticals to Present at the J.P. Morgan 27th Annual Healthcare Conference 2
(Date:9/23/2014)... Fruit and vegetable consumption could be as good for ... , The research, conducted by the University of Warwick,s ... England, and published by BMJ Open focused ... mental wellbeing were consistently associated with an individual,s fruit ... mental wellbeing ate five or more portions of fruit ...
(Date:9/23/2014)... infant chimpanzees from their mothers are well documented, little ... of early life experience. In a year-long study, scientists ... that those who were removed from their mothers early ... performers are likely to show behavioral and social deficiencies ... in the open-access journal PeerJ , was led ...
(Date:9/22/2014)... GAINESVILLE, Fla. --- Many native species have vanished ... University of Florida scientists have discovered how fossils ... , The key lies in organic materials found ... ancient ecosystems functioned, according to a new study ... the Journal of Herpetology . Pre-human island ...
Breaking Biology News(10 mins):Eating five a day may keep the blues away 2Chimpanzees raised as pets or performers suffer long-term effects on their behavior 2Answer to restoring lost island biodiversity found in fossils 2
... New findings from a landmark clinical trial show that although ... to develop age-related macular degeneration (AMD), a potentially blinding eye ... do not predict how patients will respond to Lucentis and ... "wet" form of AMD. This new data from the Comparison ...
... change to current dosages for sleeping medications in women ... that flu dosages for women be reconsidered as well. ... common practice, but we aren,t there yet. To accelerate ... education and clinical training, the Sex and Gender Women,s ...
... from engineers at Rensselaer Polytechnic Institute and the University of ... powerful new tool for manipulating cells. Results of the study, ... blue light can be used as a switch to prompt ... process of clustering, or oligomerization, is commonly employed by nature ...
Cached Biology News:Major clinical trial finds no link between genetic risk factors and 2 top wet AMD treatments 2Sex and gender competency essential to medical care 2Nature Methods study: Using light to control cell clustering 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products: