Navigation Links
Atherotech Receives Patent for ApoB Measurement
Date:5/19/2009

tes, high blood pressure or heart disease - or who are already taking cholesterol lowering medication - are candidates for the comprehensive VAP Test, according to Atherotech President Mike Mullen.

"The single VAP Test reports over 20 separate values, including apoB, eliminating the need for nine separate tests that would have to be run in a typical laboratory setting," commented Mullen. "The VAP Test is now well positioned to be the market leader in advanced lipid testing. It has the comprehensive lipid reporting that an increasing number of physicians and practices are requesting without the added cost, which fits nicely in our current economic and health care environment."

Mullen said the patent should have a positive impact on his company's business.

"We expect to see an increase in orders for our VAP Test because of its clinically validated ability to accurately report apoB and because it is quickly becoming more of a standard in determining heart disease risk in cholesterol testing."

The VAP Test is available nationwide and covered by most insurance providers, including Medicare and Medicaid. For more information call 877.901.8510 or visit www.thevaptest.com.

About Atherotech, Inc.

Atherotech is a cardio-diagnostic company focusing on cardiometabolic tests, including the company's patented VAP Cholesterol Test, which reports the cholesterol content of all lipids, components and subclasses. The VAP Test is the first cholesterol profile to comply with updated National Cholesterol Education Program ATP III recommendations for direct LDL measurement, which is accurate with non-fasting samples. It is the only advanced lipid profile that routinely reports all three lipoprotein parameters considered necessary by the American Diabetes Association and American College of Cardiology expert
'/>"/>

SOURCE Atherotech, Inc.
Copyright©2009 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Atherotech to Exhibit its VAP(R) Cholesterol Test at Internal Medicine 2009 in Philadelphia
2. Atherotech Unveils New Cardiometabolic Test Panels
3. Atherotech to Exhibit the VAP(R) Cholesterol Test at ACC.09 in Orlando
4. Atherotech Announces Addition of ApoAI Heart Disease, Diabetes Risk Marker to VAP(R) Test
5. Atherotech to Exhibit VAP(R) Cholesterol Test at American Heart Association Scientific Sessions 2008
6. VAP(R) Cholesterol Test From Atherotech Covers an Additional 9 Million of Florida Insured
7. Atherotech to Exhibit the VAP Test at Internal Medicine 2008
8. Atherotech VAP Cholesterol Test Meets Updated ADA, ACC Measurement and Treatment Guidelines for High Risk Patients
9. Atherotech to Exhibit the VAP Test (R) at ACC 2008 Meeting in Chicago
10. VAP Cholesterol Test From Atherotech Covers 90 Percent of Arizona Insured
11. Atherotech Says Detailed Cholesterol Test Can Help Doctors and Patients Choose Best Therapy
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: