Navigation Links
Aridis Pharmaceuticals Announces Acquisition of Monoclonal Antibody Products and Technologies From Kenta Biotech
Date:5/17/2013

eadership position in anti-infective mAbs. This promising new class of anti-infectives presents very significant advantages over conventional antibiotics that are prone to drug resistance' said Aridis Founder & Chief Scientific Officer Dr. Vu Truong .

This portfolio of mAb products will be folded into Aridis' Switzerland subsidiary to facilitate completion of the ongoing clinical trial and provide access to an excellent range of resources in Switzerland. Our current financing activities will fund the completion of the on-going phase 2a clinical trial in pneumonia patients infected with antibiotic resistant strains of S. aureus (e.g. MRSA, MSSA), and also to advance two additional IND stage products through phase 1 clinical testing. These clinical trials will be completed within 18-24 months.

About Aridis

Aridis Pharmaceuticals is a privately held biopharmaceutical company headquartered in San Jose, CA, with a subsidiary in Switzerland. The Company is focused on the development of novel anti-infective drugs for the treatment of lung infections and other surface infections. Our products target infectious diseases that have a significant impact on life expectancy and address acute unmet medical needs including: nosocomial infections [Hospital acquired pneumonia, ventilator associated pneumonia], lung infections associated with cystic fibrosis, and severe wound infections. Aridis has a best-in-class anti-infective monoclonal antibody which targets P. aeruginosa (AerucinTM). Complementing the mAbs is a broad spectrum anti-infective, gallium citrate (PanaecinTM), which has shown preliminary efficacy and safety in a human clinical trial. The Company is a recognized global leader in biopharmaceutical stabilization formulation technologies and has successfully attained ov
'/>"/>

SOURCE Aridis Pharmaceuticals
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Keryx Biopharmaceuticals, Inc. Announces Upcoming Poster Presentations of Zerenex™ (Ferric Citrate) at the Upcoming American Society of Nephrology Kidney Week 2011 Annual Meeting
2. Convergence Pharmaceuticals Initiates Phase I Multiple Ascending Dose Study for CNV2197944
3. TetraLogic Pharmaceuticals Announces Initiation of a Phase 1/2 Clinical Trial of TL32711 in Patients with Acute Myelogenous Leukemia (AML)
4. Questcor Pharmaceuticals to Present at the Oppenheimer Healthcare Conference on December 13, 2011
5. Synergy Pharmaceuticals, Inc. Files Suit Against Ironwood Pharmaceuticals, Inc. and its Chief Scientific Officer and Senior VP of R&D, Dr. Mark G. Currie
6. Acumen Pharmaceuticals Regains Worldwide Rights to Anti-ADDL Antibody Therapeutics and Diagnostics for Alzheimers Disease From Merck
7. Inspiration Biopharmaceuticals Moves Corporate Headquarters to Cambridge, Massachusetts
8. Ampio Pharmaceuticals Awarded Canadian Composition of Matter Patent That Strengthens IP Protection for Its Key Drug Ampion™
9. Amylin Pharmaceuticals to Present at the 30th Annual J.P. Morgan Healthcare Conference
10. Inovio Pharmaceuticals Promotes Niranjan Sardesai to Chief Operating Officer
11. Keryx Biopharmaceuticals to Present at JP Morgans 30th Annual Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... 2014 SPIE Fellow Glenn Boreman, Professor ... Science and Director of the Center for Optoelectronics and ... Charlotte, and co-founder and Chairman of the Board of ... 2015 Vice President of SPIE, the international society for ... announced recent election results at the Annual General Meeting ...
(Date:8/28/2014)... A new research platform uses a ... tiny structures undergoing stress and heating, an ... designs for microelectronics and batteries., This new ... about how heating and the surface stress ... Researchers have discussed the merits of surface-stress ...
(Date:8/28/2014)... BOSTON , Aug. 28, 2014  Next month, executives ... at three key industry events beginning with Patient-Centered Clinical ... Hotel in Boston , September 4-5. Patient ... , and Aaron Fleishman will share insights on ... how a variety of tactics – from media to mobile ...
(Date:8/28/2014)... Florida State University research team has led to a ... white light, and convert photon energy directly to mechanical ... , Biwu Ma, associate professor in the Department of ... Engineering, created the molecule in a lab about a ... creation has many other unique capabilities. , For example, ...
Breaking Biology Technology:Glenn Boreman, UNC Professor and Plasmonics Co-Founder, Elected to SPIE Presidential Chain 2New analytical technology reveals 'nanomechanical' surface traits 2New analytical technology reveals 'nanomechanical' surface traits 3BBK Worldwide Leads Sessions at Key September Events 2Novel 'butterfly' molecule could build new sensors, photoenergy conversion devices 2
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: