Navigation Links
Arena Pharmaceuticals Announces Fourth Quarter and Full Year 2007 Financial Results
Date:2/27/2008

in the fourth quarter of 2007, compared to $38.1 million in the fourth quarter of 2006. Research and development expenses totaled $149.5 million in the full year ended December 31, 2007, compared to $103.4 million in the full year ended December 31, 2006. The increase in research and development expenses in 2007 over 2006 is primarily attributable to clinical development costs for Arena's Phase 3 clinical program for lorcaserin, its drug candidate for the treatment of obesity, and a Phase 2a clinical trial of APD125, its drug candidate for the treatment of insomnia, as well as an increase in the number of its research and development personnel. Research and development expenses in 2007 included $4.2 million in non-cash, share-based compensation expense, compared to $2.9 million in 2006. General and administrative expenses totaled $6.9 million in the fourth quarter of 2007, compared to $5.2 million in the fourth quarter of 2006. General and administrative expenses totaled $26.6 million in the full year ended December 31, 2007, compared to $18.5 million in the full year ended December 31, 2006. The increase in general and administrative expenses in 2007 over 2006 is primarily attributable to an increase in Arena's general and administrative personnel and non-cash, share-based compensation expense, as well as costs related to Arena's growing and maturing patent portfolio. General and administrative expenses in 2007 included $4.6 million in non-cash, share-based compensation expense, compared to $2.1 million in 2006. Total patent costs, including patent costs related to partnered programs, were $6.4 million in the full year ended December 31, 2007, compared to $4.5 million in the full year ended December 31, 2006.

Cash, cash equivalents and short-term investments totaled $398.2 million at December 31, 2007, and included net proceeds of $103.2 million from a public offering completed in November 2007. Approximately 72.3 million shares of Arena's common stock were
'/>"/>

SOURCE Arena Pharmaceuticals, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11

Related biology technology :

1. Arena Pharmaceuticals to Present at the Bear Stearns 20th Annual Healthcare Conference
2. Arena Pharmaceuticals Continues Phase 3 BLOOM Obesity Trial Following Independent Echocardiogaphic Data Safety Monitoring Board Review
3. Arena Pharmaceuticals Continues Phase 3 BLOOM Obesity Trial Following Independent Echocardiographic Data Safety Monitoring Board Review
4. Arena Pharmaceuticals Selected to Join New NASDAQ NeuroInsights Neurotech Index
5. Arena Pharmaceuticals to Present at Two Upcoming Investor Conferences
6. Arena Pharmaceuticals to Report Third Quarter 2007 Financial Results and to Host Conference Call and Webcast on Wednesday, October 17, 2007
7. Arena Pharmaceuticals Announces Third Quarter 2007 Financial Results
8. Arena Pharmaceuticals to Present at the Acumen BioFin Rodman & Renshaw 9th Annual Healthcare Conference
9. Arena Pharmaceuticals Appoints Phillip M. Schneider and Randall E. Woods to Board of Directors
10. Arena Pharmaceuticals Initiates Second and Third Pivotal Trials Evaluating Lorcaserin for the Treatment of Obesity
11. Arena Pharmaceuticals Enters Into Strategic Agreements for the Manufacture of Pharmaceutical Material, Including Lorcaserin
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... , Jan. 22, 2015  Transwestern | RBJ today announces the ... office space for Shire a leading biopharmaceutical company, at Two ... | RBJ,s Robert Richards , president, and Brian ... for the entire five-floor building at 95 Hayden Ave. ...
(Date:1/22/2015)... January 21, 2015 Cambridge Semantics, the leading ... today announced that 2014 was a record-breaking year across the ... of the Anzo Smart Data Platform and our Smart Data ... insights from diverse data which led to record growth for ...
(Date:1/22/2015)... January 22, 2015 Crystal Diagnostics (CDx) Xpress ... it has received AOAC-PTM Certifications for the six non-O157 Shiga ... O145; collectively referred to as STEC or the “Big-6”) as ... forming unit (cfu) per 325 g of raw ground beef ...
(Date:1/22/2015)... Dr. Greg Leyer of UAS Labs recently was ... Pre-Conference seminar on probiotics in San Diego, CA. , ... conference for health care professionals. This year’s pre-conference seminar was ... in health. Dr. Leyer spoke about the emerging topics and ...
Breaking Biology Technology:Transwestern | RBJ Advises Shire in 202,000 SF Lease, Creating Boston's Largest Suburban Biotech Campus 2Cambridge Semantics Announces Record Results for 2014 2Crystal Diagnostics Awarded AOAC-PTM Accreditation for the Rapid Detection of “Big 6” E.coli Food Pathogens 2
... Vaccine Induced Neutralizing Antibodies and Protected Mice upon ChallengeROCKVILLE, ... NVAX ) announced results from a preclinical study of ... the viral fusion (F) protein. The virus utilizes ... respiratory tract and cause illness. Novavax,s RSV-F ...
... Boston Scientific Corporation (NYSE: BSX ) ... ended December 31, 2008. Subsequent to the release ... a patent litigation settlement and, as expected, finalized a ... U.S. Generally Accepted Accounting Principles, these events are required ...
... 26 InterMune, Inc.,(Nasdaq: ITMN ) today announced ... December 31, 2008. InterMune reported a net loss for ... share, compared with a,net loss of $25.9 million, or $0.67 ... Dan Welch, Chairman, Chief Executive Officer and ...
Cached Biology Technology:NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 2NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 3NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 2Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 3Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 5Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 6Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 7Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 8Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 9Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 2InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 3InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 4InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 5InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 6InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 7InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 8InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 9InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 11InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 12
(Date:1/22/2015)... OXFORD, Conn. , Jan. 20, 2015 NXT-ID, Inc. (NASDAQ: ... growing mobile commerce market, reports on the recent success of the Wocket™ ... Wocket smart wallet was named as one of the ... of the "5 Best Products Launched At CES So Far" by Newseveryday.com ...
(Date:1/22/2015)... MUNICH , January 22, 2015 ... its tenth year  The European Patent Office to present ... Two British nominations to be featured: Christofer Toumazou ... week featuring former finalists and winners of the Award   ...
(Date:1/22/2015)... 2015 Infinisource has launched its new NXG series of ... G2 sets a higher standard for collecting attendance and labor ... With plug-and-play installation, touch screen interface and seamless connection to ... time collection solution for the small to mid-size employer. ...
Breaking Biology News(10 mins):CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 2CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 3Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 2Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 3Infinisource's NXG series sets new time clock standard 2
... a female insect in order to attract males for pollination. ... Biology found that breeding two of these orchid species ... This new odour had no effect on normal solitary bees ... of wild bee that never visited any of the parent ...
... , Nerve cells communicate with each other by means ... cells exchange charged ions with their environment. However, the ... although some theories predicted a relation between the chloride ... Institute of Neurobiology in Martinsried were now able to ...
... A Georgetown University Medical Center research team has been ... Abuse to discover and develop new smoking cessation drugs ... Kenneth Kellar, PhD, a professor of pharmacology at GUMC ... $4.6 million. The theory, developed in Kellar,s lab ...
Cached Biology News:Chloride channels render nerve cells more excitable 2Chloride channels render nerve cells more excitable 3GUMC to develop smoking cessation aids based on unconventional nicotine addiction theory 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: