Navigation Links
Antigen Express Cancer Vaccine Highlighted in Expert Opinion on Biological Therapy
Date:9/19/2011

WORCESTER, Mass. and TORONTO, Sept. 19, 2011 /PRNewswire/ -- Generex Biotechnology Corporation's (OTCBB: GNBT) (www.generex.com) wholly-owned subsidiary, Antigen Express, Inc. (www.antigenexpress.com), today announced that AE37, a novel HER-2/neu-targeted vaccine for the treatment of breast, prostate, and other cancers, is reviewed in the September 2011 issue of Expert Opinion on Biological Therapy, a peer-reviewed, international journal publishing review articles and original papers on all aspects of biological therapy, providing expert opinion on the scope for future development.

(Logo:  http://photos.prnewswire.com/prnh/20110106/NY25057LOGO-b)

In the article titled "AE37: a novel T-cell-eliciting vaccine for breast cancer," senior author Col. George E. Peoples, M.D., F.A.C.S., Brooke Army Medical Center, focuses on the concept that AE37 vaccine's Ii-Key hybrid technology "has improved the potency of the AE37 vaccine to the point where it is capable of inducing immune responses even without immunoadjuvant," and that "preclinical and early clinical trials of the AE37 show potential promise for this CD4+ T-cell-eliciting vaccine in the adjuvant treatment of breast cancer."  

The article contrasts the unique ability of AE37 to stimulate CD4+ helper T cells with other therapeutic peptide vaccines that primarily stimulate CD8+ T cells, including E75 and GP2.  Another difference is that AE37 can be used to treat twice the patient population than either E75 or GP2. The article further outlines many of the trials conducted to date with AE37, including Phase I clinical trials in both breast and prostate cancer and the ongoing controlled, randomized, and single-blinded Phase II trial in breast cancer. While preliminary, the authors noted an approximate 40% reduction in the rat
'/>"/>

SOURCE Generex Biotechnology Corporation
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Generex Provides Update on Spinout of Antigen Express
2. Generex Announces Publication of Studies with the Mayo Clinic Confirming and Extending the Antigen Express Ii-Key Platform Technology
3. Generex Announces Publication on Application of Antigen Express Technology for Early Detection of Type 1 Diabetes
4. PharmAthene Submits White Paper to BARDA for Advanced Development Funding for SparVax(TM) - Novel Recombinant Protective Antigen Anthrax Vaccine
5. BARDA Announces Modification to Development Approach for Recombinant Protective Antigen Anthrax Vaccines
6. ImaginAb, Inc. and BZL Biologics, LLC Conclude Licensing Agreement for Imaging Rights to huJ591/Prostate-Specific Membrane Antigen (PSMA)
7. Antigen Discovery, Inc. Awarded Grant for Chlamydia Vaccine Development
8. ImmunoVaccine Technologies Licenses Immunotopes Breast, Ovarian and Prostate Cancer Antigens
9. Medicago succesfully expresses VLP antigen for A H1N1 strain
10. Pepscan Achieves a Breakthrough With CLIPS Immunogen Technology: Synthetic Peptide Antigen is Able to Induce Fully Functional Antibodies Against a Formerly Intractable GPCR Target CXCR7
11. PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: