Navigation Links
Anaptys Biosciences Appoints R. Scott Greer to Board of Directors
Date:10/8/2007

Former Chairman and CEO of Abgenix Brings Wealth of Industry Experience

LA JOLLA, Calif., Oct. 8 /PRNewswire/ -- Anaptys Biosciences, Inc., a privately-held biopharmaceutical product company, today announced the appointment of R. Scott Greer to the company's board of directors. Mr. Greer, a founder and former chairman and CEO of Abgenix, is a seasoned entrepreneur and executive with more than 20 years of experience in the biopharmaceutical industry.

"Scott Greer is a stellar addition to Anaptys' board," said Tom Smart, chairman and chief executive officer of Anaptys. "Scott's intimate knowledge of the therapeutic antibody space, combined with his impressive talent and track record for building and monetizing successful ventures, will bring invaluable perspective to the Anaptys team as we move toward commercialization of our novel technology and product portfolio."

Mr. Greer is a private investor and active consultant to the life sciences industry. He currently serves as managing director of Numenor Ventures, LLC. In 1996, he founded Abgenix, Inc., a biotechnology company focused on developing and commercializing human antibody based therapeutics, and served as its CEO from inception through 2002 and as its chairman from 2000 until 2006. In 2006, Abgenix was acquired by Amgen, Inc. in a cash transaction worth approximately $2.2 billion.

Mr. Greer also served as chairman of the board of Sirna Therapeutics, Inc. In 2007, Merck acquired Sirna for approximately $1.1 billion in cash.

"Anaptys is raising the bar for antibody-based therapeutics by addressing unsolved problems in protein selection and optimization," said Mr. Greer. "Their technology has true potential to revolutionize the field of therapeutic antibodies. I am excited to contribute to the leadership of this company during this time of significant progress and opportunity."

Prior to forming Abgenix, Mr. Greer spent five years at Cell Genesys, Inc., a biotechnology comp
'/>"/>

SOURCE Anaptys Biosciences, Inc.
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Perscitus Biosciences secures $250K Commerce loan
2. Wisconsin biosciences rise to the challenge
3. Quintessence Biosciences advances cancer drug
4. Quintessence Biosciences names new president
5. Caden Biosciences may signal critical mass
6. Wisconsin start up Primorigen Biosciences corrals out-of-state investment
7. WARF signs licensing pact with BD Biosciences
8. Fisher Biosciences contracts with Madison-based GenTel BioSurfaces
9. State awards QRG Biosciences development grant
10. EMD Biosciences partners with European biotech company
11. Quintessence Biosciences forms cancer therapeutic advisory board
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: