Navigation Links
Anadys Pharmaceuticals Reports Second Quarter 2008 Financial Results and Highlights
Date:7/30/2008

SAN DIEGO, July 30 /PRNewswire-FirstCall/ -- Anadys Pharmaceuticals, Inc. (Nasdaq: ANDS), a clinical-stage biopharmaceutical company dedicated to improving patient care by developing novel medicines in the areas of hepatitis C and oncology, today reported its financial results and highlights for the second quarter ended June 30, 2008.

"The first half of 2008 has been a remarkably productive time at Anadys," said Steve Worland, Ph.D., President and CEO. "Through the focused efforts of our employees, we have initiated dosing in three clinical programs in six months. For hepatitis C, we commenced dosing in our Phase I clinical trial of ANA598 during the second quarter, and are happy to announce today that we have now commenced dosing in our Phase I clinical trial of ANA773 for HCV. We also continue to enroll patients in our ongoing clinical trial of ANA773 for oncology. We are proud of our progress to date and look forward to achieving additional clinical milestones in the coming months."

Financial Results

As of June 30, 2008, the Company's cash, cash equivalents and securities available-for-sale totaled $42.1 million.

During the second quarter of 2008 the Company had no revenue, compared to $1.3 million for the same quarter of 2007. The revenue in the second quarter of 2007 was primarily derived from the amortization of an upfront payment and a milestone payment under a prior collaboration.

Research and development expenses were $5.5 million for the second quarter of 2008, compared to $7.0 million for the second quarter of 2007. The $1.5 million decrease primarily resulted from cost savings derived from Anadys' completed strategic restructuring and associated termination of prior development programs. The
'/>"/>

SOURCE Anadys Pharmaceuticals, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7

Related biology technology :

1. Anadys Pharmaceuticals to Report Second Quarter 2008 Financial Results
2. Anadys Pharmaceuticals to Present at Two Upcoming Investor Conferences
3. Anadys Pharmaceuticals Reports First Quarter 2008 Financial Results and Highlights
4. Anadys Pharmaceuticals to Report First Quarter 2008 Financial Results
5. Anadys Pharmaceuticals to Present at the CanAccord Adams Hepatitis C Conference
6. Anadys Pharmaceuticals to Present at the Cowen and Company Healthcare Conference
7. Anadys Pharmaceuticals Commences Phase I Clinical Trial of ANA773 in Cancer Patients
8. Anadys Pharmaceuticals to Present at the Susquehanna SIGnificant Options in Healthcare Conference
9. Anadys Pharmaceuticals to Report Fourth Quarter and Year-End 2007 Financial Results
10. Anadys Pharmaceuticals to Present at the BIO CEO & Investor Conference
11. Anadys Pharmaceuticals to Present at the JPMorgan Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/26/2014)... (PRWEB) November 25, 2014 Miles Holder, ... joined the Graphel Carbon Products team as Sales/Marketing Manager. ... marketing, and customer service for the graphite industry. , ... to our team,” stated Dave Trinkley, VP of Market ... wide range of experience in the graphite industry, along ...
(Date:11/26/2014)... 2014 Theravalues Corporation est fier d,annoncer ... européen au salon Hi Europe 2014 (du 2 ... Curcumine la plus biodisponible actuellement sur ... à des ingrédients approuvés par les règlements européens. ... présent dans la racine de curcuma ( Curcuma ...
(Date:11/24/2014)... Nov. 24, 2014  IGI Laboratories, Inc. (NYSE MKT: ... specialty generic pharmaceutical company, today announced it has submitted ... U.S. Food and Drug Administration (FDA), which brings the ... seven, with eighteen submissions now pending at the FDA. ... CEO of the Company, commented, "Our team here at ...
(Date:11/24/2014)... , November 24, 2014   ... online on ScienceDirect   Elsevier , a ... services, is pleased to announce the launch of the latest ... Current Opinion in Food Science . ... will provide specialists with a new platform to keep up-to-date ...
Breaking Biology Technology:Miles Holder Joins Graphel Corporation as Sales/Marketing Manager 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 3IGI Laboratories, Inc. Announces ANDA Submission 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3
... Aug. 25 Reportlinker.com announces that a new ... Protein Kinase Therapeutics in Oncology ... http://www.reportlinker.com/p0284973/Protein-Kinase-Therapeutics-in-Oncology---Where-to-Commercialize.html This report comprises defined ... protein kinase drugs (990 projects) within the portfolio ...
... KONG, Aug. 25 bioserie is first to market ... give earth-conscious Apple device owners the protection they demand ... production. bioserie,s unique use of the latest in bioplastics ... and the prevention of environmental toxic pollution once the ...
... meet three goals in the production of biofuels ... production and ecological sustainability. Syracuse University,s Radhakrishna Sureshkumar, ... in the L.C. Smith College of Engineering and ... Satvik Wani have uncovered a process that is ...
Cached Biology Technology:Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 2Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 3Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 4Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 5Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 6Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 7Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 8Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 9Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 10Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 11Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 12Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 13Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 14Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 15Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 16Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 17Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 18Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 19Reportlinker Adds Protein Kinase Therapeutics in Oncology - Where to Commercialize? 20bioserie Introduces the World's First 'Made of Plants' iPhone 4 Cover 2SU research team uses nanobiotechnology-manipulated light particles to accelerate algae growth 2
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products: