Navigation Links
American Psychiatric Foundation Announces Recipients of 2008 Awards for Advancing Minority Mental Health
Date:5/6/2008

Awards Honoring Mental Health Programs Supported by a Grant from Otsuka

America Pharmaceutical, Inc.

ROCKVILLE, Md., May 6 /PRNewswire/ -- The American Psychiatric Foundation (APF) has named three nonprofit organizations and one individual as the recipients of the fifth annual APF Awards for Advancing Minority Mental Health. The awards were presented at the 2008 APF Annual Benefit in Washington, D.C. Each organization or individual was presented a plaque, along with an award of $5,000 in honor of their work and commitment to advancing minority mental health. The awards are made possible through an unrestricted educational grant from Otsuka America Pharmaceutical, Inc.

The following individual and organizations received an award:

-- Francis G. Lu, M.D. received an award for his work in the Department

of Psychiatry at San Francisco General Hospital (SFGH) where he has

worked since 1977. Dr. Lu developed the Ethnic/ Minority Psychiatric

Inpatient Programs at SFGH and is one of the founding Board members of

the National Asian American and Pacific Islander Mental Health

Association. He produced a DVD titled "The Culture of Emotions" that

was based on the DSM-IV Outline for Cultural Formulation. He is also

a member of the California State Department of Mental Health, Cultural

Competence Advisory Committee.

-- Homes for the Brave in Bridgeport, CT received an award for providing

housing and services to homeless male veterans and non-veterans who

struggle with psychiatric and/or substance abuse problems. Homes for

the Brave (HFTB) provides case management, vocational education and

training, job assistance, and community life skills training. Through

its services and collaborations, HFTB strives to prepare homeless

individuals with the life skills necessary to reenter t
'/>"/>

SOURCE Otsuka
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. YM BIOSCIENCES ANNOUNCES PRESENTATIONS FOR AEROLEF(TM) AT AMERICAN PAIN SOCIETY ANNUAL MEETING
2. Aflac and the American Association for Cancer Research Unite to Issue Inaugural Aflac Career Development Award for Childhood Cancer Research
3. American Oriental Bioengineering to Report First Quarter 2008 Financial Results
4. FASgen, Inc. Presents Ovarian Cancer Efficacy and Toxicology Data to the American Association for Cancer Research
5. Telik Presents Preclinical Data at 99th Annual Meeting of the American Association for Cancer Research
6. SPO Medical Retains American Capital Ventures for Investor Relations Services
7. NexGenix Pharmaceuticals Presents Data on a Novel Small Molecule Inhibitor of Heat Shock Protein 90 (Hsp90) at the Annual Meeting of the American Association for Cancer Research (AACR); Scientific Advisory Board Chairman Tyler Jacks Named President-elect
8. Medarex Reports Phase 1/2 Clinical Data of MDX-060 in Lymphoma at American Association for Cancer Research Meeting
9. American Oriental Bioengineering and China Aoxing Pharmaceutical Enter Into Strategic Alliance
10. Paloma Pharmaceuticals to Present at the American Association for Cancer Research
11. Bionovo to Present Recent Findings of BN107 and BN108, Its Anticancer Agents, at the American Association of Cancer Research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: