Navigation Links
All Global Partners With HealthEngage to Provide Unique Web 2.0 Patient Insights
Date:3/24/2012

LONDON, March 23, 2012 /PRNewswire/ --

All Global, the world's leading healthcare data company, is introducing a series of patient access offers, building off developments in technology and social media to offer unique alternative solutions to traditional research methods in providing greater access to patient audiences previously too difficult to reach. The first of these new offers comes in the area of diabetes, through All Global's partnership with HealthEngage. 

"The number of patients with diabetes worldwide is skyrocketing, and innovations in social media provide a new way to engage with these patients about their condition and the complications it causes," says Tony Burke, CEO of All Global. "Our partnership with HealthEngage gives our clients access to a large and growing community of diabetics who are able to instantly share information on their health and wellbeing."

HealthEngage is a free online tool for diabetics to manage and improve their health and to share their information with their healthcare professionals. The growing community of diabetic users is active in over 172 countries and 58 languages, with members tracking, managing and sharing all aspects of their health and wellbeing. This includes glucose (with direct upload from 99% of meters) insulin, foods/diet, medications, exercise, tests, symptoms, goals, as well as general communication, notes and reminders.

Community members are supported on the web, on their mobile devices, and by email. The proprietary widget is available on 40 social networking sites, as well as a mobile application.

About All Global

Operating internationally with offices in the US and the UK with proprietary panels in North America, Latin America and Europe, All Global (http://www.allglobal.com) gathers the best quality healthcare data in the industry.

With well over a century of combined
'/>"/>

SOURCE All Global
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Fundamental steps needed now in global redesign of Earth system governance
2. MiMedx Signs Agreement with Systagenix for Global Distribution of EpiFix®
3. Scholars call for global governance overhaul to ensure Earths sustainability
4. More than half of Americans doubt US global leadership in 2020
5. Global Biotechnology Industry
6. Global Leaders in Advanced Biofuels Industry Urge Congressional Leaders to Extend Critical Tax Provisions
7. Neurocrine Biosciences to Present at the Citi 2012 Global Health Care Conference
8. Life Technologies to Present at Barclays Capital Global Healthcare Conference
9. Avanir Pharmaceuticals to Participate in Citi 2012 Global Health Care Conference
10. Regeneron Announces Presentation at the Leerink Swann 2012 Global Healthcare Conference
11. Amgen to Present at the Leerink Swann Global Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/30/2015)... SAN DIEGO , June 30, 2015 /PRNewswire/ ... Continuing Education in Biosciences (CCE/Bio) and UC San ... microbial fermentation, to be held Aug.  12 – ... agenda ).  This three-day workshop provides an intense ... in industrial biotechnology, and is well-suited to biologists, ...
(Date:6/30/2015)... VANCOUVER , June 30, 2015 /PRNewswire/ - ... a clinical stage regenerative medicine company focused on ... the first participant in its Phase 1/2 clinical ... of chronic unilateral Achilles tendinosis, has been enrolled ... to intra-tendon ultrasound-guided injections. RCT-01 is comprised of ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... has accepted the position of vice president of instruction at Chippewa Valley Technical ... “I greatly appreciated the opportunity to lead SIUE during the past three years,” ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... launched “Cannavoices,” an unprecedented digital video and broadcast initiative. Produced by filmmakers, the ... dynamic collection of legal medical cannabis stories ever assembled. , Cannavoices profiles ...
Breaking Biology Technology:UC San Diego Extension to Offer Third Annual Microbial Fermentation Workshop 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 3RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 4SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 2SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 3Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3
... Senior Management Form Company ... and Podiatry Markets, FAIRFIELD, N.J., May 13 ... newly-formed,Company, led by the founder and the key Senior ... ), will develop, license and,commercialize innovative prescription products for ...
... with CelVida Yields First Milestone, NEW YORK, May ... pioneering the pre-disease collection, processing and long-term,storage of adult ... a,site has been secured for a new stem cell ... Robin Smith, MD MBA, NeoStem,s Chairman and Chief ...
... Pte Ltd today announced that,the U.S. Food and ... SB1518, its potent and orally-active JAK2 inhibitor for ... S*BIO,s,application upon review of preclinical data which demonstrated ... of the JAK2 inhibitor., "We are pleased ...
Cached Biology Technology:Medimetriks Pharmaceuticals, Inc. Begins Operations 2NeoStem to Expand Stem Cell Collection Center Network to Florida 2NeoStem to Expand Stem Cell Collection Center Network to Florida 3S*BIO Receives Orphan Drug Designation for JAK2 Inhibitor SB1518 for the Treatment of Myeloproliferative Disorders 2
(Date:6/24/2015)... 2015 Biometry authentication provider KeyLemon today ... solution one face in. Logo ... face in, entering the expanding biometric authentication market ... biometric answer to the password problem. With advanced ... with KeyLemon, one face in allows users to ...
(Date:6/23/2015)... GARDENS, Fla. , June 23, 2015 ... identity management and authentication solutions, today announced enhanced ... strong, multi-factor authentication solution.  The enhancements build ... use of the DigitalPersona Altus platform and ... reader compatibility. In today,s environment ...
(Date:6/17/2015)... , and HILDEN, Germany , June ... QGEN ; Frankfurt Prime Standard: QIA) today launched new Investigator ... in forensic laboratories in the United States ... to simultaneously analyze multiple key genomic markers (short tandem repeats ... Quality Sensor to evaluate the quality of DNA in ...
Breaking Biology News(10 mins):KeyLemon Announces Partnership With Biometric Password Solution onefacein 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5
... fewer television advertisements for certain foods, including those for ... to a report posted online today that will appear ... Pediatrics & Adolescent Medicine , one of the JAMA/Archives ... racial gaps in exposure to all food advertising have ...
... Saber-toothed cats may be best known for their supersized canines, ... before delivering the fatal bite, says a new study in ... "saber-toothed tiger," the extinct cat Smilodon fatalis roamed ... large mammals such as bison, camels, mastodons and mammoths. Telltale ...
... worry about the effects of air pollution on their health ... and fine particles in the air during pregnancy does not ... -- a serious condition that arises only during pregnancy -- ... at Buffalo epidemiologist. , The research was conducted in ...
Cached Biology News:Kids now see fewer television ads for sweets and beverages, but more for fast food 2Why you should never arm wrestle a saber-toothed tiger 2Air pollution doesn't increase risk of preeclampsia, early delivery, study finds 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: