Navigation Links
Alexandria Real Estate Equities, Inc. Announces Pricing of Public Follow-On Offering of 7,000,000 Shares of Common Stock
Date:3/19/2009

e of the proceeds and the expected closing date of the offering. These forward-looking statements are based on the Company's present intent, beliefs or expectations, but forward-looking statements are not guaranteed to occur and may not occur. Actual results may differ materially from those contained in or implied by the Company's forward-looking statements as a result of a variety of factors, including, without limitation, the risks and uncertainties detailed in our filings with the Securities and Exchange Commission. All forward-looking statements are made as of today, and the Company assumes no obligation to update this information. For more discussion relating to risks and uncertainties that could cause actual results to differ materially from those anticipated in the Company's forward-looking statements, and risks and uncertainties to the Company's business in general, please refer to the Company's filings with the Securities and Exchange Commission, including its most recent annual report on Form 10-K and any subsequent quarterly reports on Form 10-Q.


'/>"/>
SOURCE Alexandria Real Estate Equities, Inc.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Alexandria Real Estate Equities, Inc. Reports Third Quarter 2007 Results
2. Alexandria Real Estate Equities, Inc. Features Green Buildings and Sustainable Operations Initiatives and Tour at 2008 BIO
3. Coherent Announces Restatement Related to Stock-Based Compensation
4. Symmetry Medical Discloses Accounting Issues at Sheffield, UK Operating Unit and Possible Restatement
5. Angiotech announces filing of audited financial results for the year ended December 31, 2007 and restatement of results for the year ended December 31, 2006
6. Unigene Restates Policy on Analyst Reports
7. Rosetta Genomics Announces Expansion of its MicroRNA Intellectual Property Estate
8. Environmental Power Holds Ground Breaking Ceremony for Renewable Natural Gas Facility at Rio Leche Estates
9. Epeius Biotech Awarded Patents in Europe for Targeted Genetic Anti-Cancer Medicine: Company Expands Impressive Intellectual Property Estate
10. Norton & Associates Inc. Adds $3bnUSD Commercial Real Estate Investment P & L Management Holding Group; US Property Portfolio Inc.
11. BioMed Realty Trust Announces New Financing for Joint Venture With Prudential Real Estate Investors
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: