Navigation Links
Affitech and Omeros Enter Into Antibody Discovery and Development Agreement
Date:8/19/2008

SEATTLE and OSLO, Norway, Aug. 19 /PRNewswire/ -- Omeros Corporation, a Seattle-based clinical-stage biopharmaceutical company, and Affitech AS, a Norwegian human antibody therapeutics company, today announced that they have entered into an agreement for the discovery and development of fully human antibodies for Omeros' MASP-2 program. MASP-2, or mannan-binding lectin-associated serine protease-2, mediates activation of the complement system via the lectin pathway and is linked to multiple potential indications across a wide range of inflammatory diseases including macular degeneration, rheumatoid arthritis, transplant rejection and cardiovascular and renal ischemia-reperfusion injury.

"This agreement marks an important milestone in our MASP-2 program, and ensures that Omeros can access high-affinity, fully human antibodies against MASP-2," stated Gregory Demopulos, M.D., Chairman and CEO of Omeros. "We are impressed by Affitech's technology, track record and personnel, and look forward to our collaboration."

Under this collaboration, Omeros, based on its exclusive intellectual property position, will continue to advance the development of its MASP-2 program. Affitech will apply its expansive human antibody libraries and proprietary antibody discovery and screening technologies, including its AffiScreen(TM) platform and engineering methods, to generate fully human MASP-2 antibodies for Omeros. Financial terms include a technology access fee, a series of milestone payments, and royalties on net sales, payable by Omeros. No further terms of the agreement were disclosed.

"We are excited about this collaboration with Omeros," said Martin Welschof, Ph.D., CEO of Affitech. "Omeros' proprietary MASP-2 program is focused on a target with broad commercial applications, and provides Affitech the opportunity to apply our expertise, human antibody library and screening platform to a non-cancer disease field. We believe that our proven technology, to
'/>"/>

SOURCE Affitech AS; Omeros Corporation
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Omeros Appoints David A. Mann to its Board of Directors
2. Omeros Corporation Files Registration Statement for Proposed Initial Public Offering
3. Repair Stem Cell Institute Announces Industrys First Standards of Excellence for Global Stem Cell Treatment Centers to Protect Patients from Less-than-Competent Therapeutics
4. American Laser Centers Opens Three Minneapolis-St. Paul Area Clinics
5. Chromos enters into an Arrangement Agreement
6. NeoStem Forges Ahead in Its Plan to Open Adult Stem Cell Collection Centers in Key Locations that Can Serve as Hubs to Service Clients Nationwide
7. A Statement From Larry Corey, MD, of the HIV Vaccine Trials Network Regarding the New HIV Infection Statistics Released Today by the Centers for Disease Control
8. Poniard Pharmaceuticals to Present at the 4th Annual Moores UCSD Cancer Center Translational Oncology Symposium
9. Stem Cell Transplantation Research at The Cancer Center at Hackensack University Medical Center Aims to Develop Designer Transplants
10. Hutchinson Center Receives $7.6 Million Federal Grant to Study How Genetic Variations Influence Risk of Common Diseases
11. China Biologic Products Honored with the Advanced Technology Certification for Foreign-Funded Enterprises
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: