Navigation Links
Aegera Therapeutics Initiates a Randomized Phase 2 Study with AEG35156 for the Treatment of Hepatocellular Carcinoma

MONTREAL, Jan. 26 /PRNewswire/ - Aegera Therapeutics Inc. announced today the successful completion of a dose-ranging Phase 1 study and the initiation of a randomized Phase 2 study of AEG35156 in combination with sorafenib for the treatment of patients with advanced hepatocellular carcinoma (primary liver cancer).

This new study, entitled "A Phase 2, Open-Label Study of The X-Linked Inhibitor of Apoptosis (XIAP) Antisense AEG35156 in Combination with Sorafenib in Patients With Advanced Hepatocellular Carcinoma", is being conducted in Hong Kong. The study is projected to recruit approximately 50 patients with two thirds receiving the combination of AEG35156 and sorafenib and one third receiving sorafenib alone.

"We are pleased with the conduct and results of the Phase 1 portion of this trial. AEG35156 appears to be well tolerated when given in combination with sorafenib. We are now focused on completing recruitment to the randomized Phase 2 portion of the clinical trial to determine if the AEG35156/sorafenib combination can bring an additional therapeutic benefit to this under-served oncology population," stated Dr. Jacques Jolivet, Senior Vice-President of Clinical Development of Aegera.

About AEG35156

AEG35156 is a 2nd generation antisense oligonucleotide which targets XIAP; it is designed to lower the apoptotic threshold of cancer cells, enhancing their sensitivity to intrinsic death and chemotherapy, without harming healthy cells. Other currently enrolling studies include a randomized Phase 2 study for the treatment of acute myeloid leukemia and a Phase 1/2 monotherapy study in CLL/indolent B-cell lymphomas, which is fully funded by The Leukemia and Lymphoma Society of North America.

About Aegera Therapeutics Inc.

Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Human Genome Sciences and Aegera Therapeutics Announce Licensing and Collaboration Agreement on Novel Anti-Cancer Drugs
2. Aegera initiates Phase 1 clinical trial of AEG33773 - A small molecule in development for diabetic neuropathic pain
3. Aegera Therapeutics welcomes two experienced executives to its board of directors
4. Aegera Therapeutics collaboration with Human Genome Sciences leads to the initiation of a Phase 1 clinical trial with lead IAP inhibitor HGS1029 and receipt of first milestone payment
5. Aegera Therapeutics phase 1/2 clinical trial results selected for oral presentation at 2008 ASH Annual Meeting
6. Aegera Therapeutics Initiates A Randomized Phase 2 Combination Study of AEG35156 for 1st Line Treatment of Non-Small Cell Lung Cancer
7. Aegera Initiates Phase 2 Clinical Trial Of AEG33773 - A Small Molecule Targeting Neuropathic Pain
8. Aegera Therapeutics Initiates a Randomized Phase 2B Study with AEG35156 for the Treatment of Acute Myeloid Leukemia (AML)
9. Vicus Therapeutics to Present at the 234th American Chemical Society National Meeting in Boston, MA
10. DJO Incorporateds Pending Merger With ReAble Therapeutics Clears U.S. Antitrust Review
11. PeriCor Therapeutics Announces Closing of Licensing Agreement for Acadesine with Schering-Plough Corporation
Post Your Comments:
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: