Navigation Links
Advanced Cell Diagnostics Completes $12 Million Series B Financing
Date:11/1/2012

HAYWARD, Calif., Nov. 1, 2012 /PRNewswire/ -- Advanced Cell Diagnostics, Inc., a world leader in the field of in situ nucleic acid detection for life science research and clinical diagnostics, announced today that it has completed its $12 million Series B equity financing. New Leaf Venture Partners, a leader in healthcare technology venture investing, and the existing investor Morningside Ventures participated in the round.

Proceeds from the financing will be used to support the commercial expansion of its proprietary technology RNAscope®-based products and services into the life science research market and accelerate the entry of RNAscope into the clinical diagnostics market.

"New Leaf is excited to partner with ACD. Immunohistochemistry and FISH are well established technologies to monitor proteins and DNA respectively and each represents more than a billion dollar market today. ACD's technology is the first that we have seen which allows researchers to robustly visualize and quantify RNA in tissue. As such, we expect it to open up a large untapped market and become a mainstay in basic and translational research, while at the same time accelerating the development of advanced diagnostics," said Dr. Michael Dybbs, Principle of New Leaf Venture Partners.

"We have been most impressed by ACD's success in achieving all of its major milestones in the past four years. The RNAscope technology has proven to be a game changer in biomarker research and promises a new paradigm shift in clinical diagnostics development," said Dr. Gerald Chan, Co-Founder of Morningside Ventures.

"This oversubscribed round of financing is an important validation of the market potential of our RNAscope technology and it underscores the promise of our RNAscope-based diagnostic pipeline," said Dr. Yuling Luo, Founder, President and CEO of ACD, "We now have the resources to take ACD to the next level."

About RNAscope
RNAscope technology is the
'/>"/>

SOURCE Advanced Cell Diagnostics, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Hologic to Showcase 3D Mammography (Breast Tomosynthesis) and Other Advanced Womens Imaging Technologies at RSNA 2011, the Largest Radiology Show in the World
2. Roche NimbleGen and BGI Develop Advanced MHC Region Capture Technology for Human Disease and Biomedical Research
3. Argos Therapeutic Arcelis™ Immunotherapy AGS-003 in Combination With Sunitinib Shows Statistically Significant Correlation of Immune System Response to Overall Survival in Phase 2 Study in Patients with Advanced Renal Cell Carcinoma (RCC)
4. Global Leaders in Advanced Biofuels Industry Urge Congressional Leaders to Extend Critical Tax Provisions
5. CareFusion Announces 510(k) Clearance and U.S. Launch of New Advanced Electrodiagnostic System
6. QIAGEN Joins Grand Challenges in Global Health Initiative to Bring Advanced Point-of-Care Diagnostics to Worlds Poorest Countries
7. Algae.Tec Announces Commencement of Australian Advanced Biofuels Facility Commissioning
8. Bayer Advanced(TM) Sets Sights on New Partnerships in 2013
9. Advanced Animal Diagnostics Adds Sales & Marketing Leadership
10. MAQUET MEDICAL SYSTEMS USA LAUNCHES NEW TEGRIS O.R. INTEGRATION SYSTEM FOR ADVANCED SURGICAL CONTROL
11. Gevo Doesnt Infringe Butamaxs 017 Patent; Gevo was First to Invent Enzyme in 017 Patent; Gevo has Advanced Beyond That and Now Uses Different Enzymes
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... N.Y., Nov. 5 BioSpecifics Technologies Corp. (Nasdaq: ... today announced its financial results for the third quarter ... happy that, in September of this year, the FDA,s ... 12-0, the approval of XIAFLEX(TM) for the treatment of ...
... November 5, 2009 Senomyx, Inc. (Nasdaq: SNMX ), ... discover novel flavor ingredients for the food, beverage, and ingredient ... results for the third quarter ended September 30, 2009. ... compared to $4.0 million for the third quarter of 2008, ...
... PLYMOUTH MEETING, Pa., Nov. 5 /PRNewswire-Asia-FirstCall/ -- BMP Sunstone,Corporation (Nasdaq: ... the Company plans to release third quarter 2009 financial results ... The Company will hold a conference call ... quarter 2009 results. Listeners may access the call by,dialing ...
Cached Biology Technology:BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 2BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 3BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 4BioSpecifics Technologies Corp. Reports Third Quarter 2009 Financial Results 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 2SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 3SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 4SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 5SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 6SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 7SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 8SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 9SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 10SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 11SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 12SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 13SENOMYX ANNOUNCES CORPORATE UPDATE AND THIRD QUARTER 2009 FINANCIAL RESULTS 14BMP Sunstone to Report Third Quarter 2009 Financial Results 2
(Date:10/15/2014)... our ability to assess the pandemic risk from strains ... we must not allow ourselves to become complacent that ... international consortium of scientists. , Influenza pandemics arise when ... yet to develop widespread immunity – spreads in the ... the past 100 years, the worst of which – ...
(Date:10/15/2014)... an unexpected extent. The outbreak does not follow the ... a new disease dynamic in regions, where it has ... National Academy of Sciences Leopoldina, acatech – the German ... the German Academies of Sciences and Humanities have presented ... the statement the academies call for the following consequences ...
(Date:10/15/2014)... the 44th Rosenstiel Award for Distinguished Work in Biomedical ... the mechanisms of genomic instability and its implications for ... second alumnus to win the Rosenstiel Award; the first, ... Alt is the Charles A. Janeway Professor of Pediatrics ... an investigator at the Howard Hughes Medical Institute at ...
Breaking Biology News(10 mins):Scientists 'must not become complacent' when assessing pandemic threat from flu viruses 2Academies call for consequences from the Ebola virus epidemic 2Academies call for consequences from the Ebola virus epidemic 3Academies call for consequences from the Ebola virus epidemic 4Academies call for consequences from the Ebola virus epidemic 5Brandeis awards 44th Rosenstiel Award to pioneering geneticist Fred Alt 2
... in Spanish . An Agricultural Research ... other insects over vast acreage so their movements can be ... affordable. That,s according to recently published research by ... Research Center in Maricopa, Ariz., and his collaborators at the ...
... Plants and people alike face critical choices as ... seedsor babies--or many small, poorly-provisioned ones. Different species ... diversity of life forms: Darwin,s "endless forms most ... at the Smithsonian Tropical Research Institute argues that ...
... WI, February 15, 2010 -- Agricultural nonpoint source ... leading sources of pollution in rivers and water ... are making concerted efforts to reduce these pollutions ... As promising and effective BMPs, vegetated buffers are ...
Cached Biology News:New assay helps track termites and other insects 2Stress and trade-offs explain life's diversity: New Smithsonian model 2A review of vegetated buffer efficacy 2
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: