Navigation Links
Access Pharmaceuticals Presents at American Chemical Society Annual Fall Meeting in Boston, MA
Date:8/24/2010

grams/prolindac/">ProLindac™, currently in Phase II clinical testing of patients with ovarian cancer, and MuGard™ for the management of patients with mucositis. The company also has other advanced drug delivery technologies including Cobalamin™-mediated targeted delivery and oral drug delivery, its proprietary nanopolymer delivery technology based on the natural vitamin B12 uptake mechanism and Thiarabine, a new generation nucleoside analog which has demonstrated both pre-clinical and clinical activity in certain cancers. For additional information on Access Pharmaceuticals, please visit our website at www.accesspharma.com.

This press release contains certain statements that are forward-looking within the meaning of Section 27a of the Securities Act of 1933, as amended, and that involve risks and uncertainties. These statements include those relating to: our cash burn rate, clinical trial plans and timelines and clinical results for ProLindac, MuGard, Thiarabine and Cobalamin and other product candidates, our ability to achieve clinical and commercial success and our ability to successfully develop marketed products. These statements are subject to numerous risks, including but not limited Access' need to obtain additional financing in order to continue the clinical trial and operations and to the risks detailed in Access' Annual Reports on Form 10-K and other reports filed by Access with the Securities and Exchange Commission.Contact: CompanyContact: Investor RelationsChristine BerniDonald C. Weinberger/Diana Bittner (media)Director of Investor RelationsWolfe Axelrod We
'/>"/>

SOURCE Access Pharmaceuticals, Inc.
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4

Related biology technology :

1. US Oncology Helps Deliver Latest Cancer Therapies Through Local Community Access to Cutting Edge Research
2. Orchestrall Sponsors China Business Toolbox: Brings Focus to the How and When of China Market Access
3. DuPont Enhances its PROaccess℠ Business Strategy Through Acquisitions
4. Maximize Market Research to Improve Formulary Access Within Managed Markets Sector
5. Chinas first open-access journal Nano Research listed in Science Citation Index
6. Sudek of Tech Coast Angels Announces Networks Increased Commitment to Entrepreneurship and Innovation Through New Easy-Access Programs
7. Access Pharmaceuticals Provides Update on MuGard Commercial Launch in Europe
8. Investor Relations Firm Access IR/PR and The Communications Strategy Group Announce Strategic Alliance
9. avVaa World Health Care Products Inc. Announces Access via Social Media Websites
10. Access Pharmaceuticals Provides Update on ProLindac(TM)Clinical Development Plan
11. Access Pharmaceuticals to Present at the Rodman & Renshaw Annual Healthcare Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: