Navigation Links
AEterna Zentaris Announces Termination of Agreement with sanofi-aventis U.S. for the Development, Commercialization and Licensing of Cetrorelix in Benign Prostatic Hyperplasia
Date:12/18/2009

QUEBEC CITY, Dec. 18 /PRNewswire-FirstCall/ - AEterna Zentaris Inc. (NASDAQ: AEZS; TSX: AEZ) (the "Company"), a global biopharmaceutical company focused on oncology and endocrine therapy, today announced the termination of its agreement with sanofi-aventis U.S. ( SNY) dated March 5, 2009 for the development, commercialization and licensing of cetrorelix in benign prostatic hyperplasia (BPH) for the U.S. market, following the Company's announcement last week of the results for its European Phase 3 study for cetrorelix in BPH. Termination of the agreement will be effective January 9, 2010.

Cetrorelix, a luteinizing hormone-releasing hormone (LHRH) antagonist, had been the object of a Phase 3 program in BPH, a non-cancerous enlargement of the prostate which, as announced by the Company last week, did not meet its primary endpoint.

Juergen Engel, Ph.D., AEterna Zentaris President and CEO stated, "The termination of our agreement with sanofi-aventis U.S. was expected in light of last week's announcement. Our clinical development efforts will now be focused on the following late-stage compounds: in oncology, Keryx, our partner and licensee in North America, has just initiated a Phase 3 trial in multiple myeloma with perifosine, our oral PI3K/Akt inhibitor compound. We are also currently evaluating further development plans for AEZS-108, our targeted doxorubicin conjugate, after recent positive Phase 2 results in ovarian and endometrial cancer. In endocrinology, we are in the process of reactivating a Phase 3 trial with our oral ghrelin agonist, AEZS-130, as a diagnostic test for adult growth hormone deficiency."

About AEterna Zentaris Inc.

AEterna Zentaris Inc. is a global biopharmaceutical company focused on oncology and endocrine therapy, with proven expertise in drug discovery, development and commerc
'/>"/>

SOURCE AETERNA ZENTARIS INC.
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. AEterna Zentaris Partner, Keryx, Initiates Phase 3 Registration Trial with Perifosine (KRX-0401) for the Treatment of Patients with Advanced Multiple Myeloma
2. AEterna Zentaris Announces Appointment of New Board Member
3. AEterna Zentaris Partner, Keryx, Reports Updated Phase 1/2 Data, Including New Survival Data, on Perifosine (KRX-0401) in the Treatment of Advanced Multiple Myeloma at the 51st Annual Meeting of the American Society of Hematology
4. AEterna Zentaris Announces Results from its European Phase 3 Study with Cetrorelix in Benign Prostatic Hyperplasia
5. AEterna Zentaris Anti-Cancer Compound, Perifosine (KRX-0401), Receives FDA Fast Track Designation for the Treatment of Relapsed/Refractory Multiple Myeloma
6. AEterna Zentaris Announces Positive Results for Phase 2 Study with LHRH-Receptor Targeted Cytotoxic Conjugate AEZS-108 in Endometrial Cancer
7. AEterna Zentaris Receives US$5.5 Million from Institutional Investors
8. AEterna Zentaris to Raise US$5.5 Million from Institutional Investors at US$1.20 Per Share
9. AEterna Zentaris to Complete Phase 3 Clinical Trial of Macimorelin (AEZS-130) as First Oral Diagnostic Test for Growth Hormone Deficiency
10. AEterna Zentaris Announces Completion of Phase 1 Study with Oral AEZS-112 in Cancer
11. AEterna Zentaris Partner, Keryx Biopharmaceuticals, Receives Orphan-Drug Designation for Perifosine (KRX-0401) for the Treatment of Multiple Myeloma
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - http://photos.prnewswire.com/prnh/20110118/MM31963LOGO ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: