Navigation Links
A revolutionary breakthrough in terahertz remote sensing
Date:10/17/2010

A major breakthrough in remote wave sensing by a team of Rensselaer Polytechnic Institute researchers opens the way for detecting hidden explosives, chemical, biological agents and illegal drugs from a distance of 20 meters.

The new, all-optical system, using terahertz (THz) wave technology, has great potential for homeland security and military uses because it can "see through" clothing and packaging materials and can identify immediately the unique THz "fingerprints" of any hidden materials.

Terahertz waves occupy a large segment of the electromagnetic spectrum between the infrared and microwave bands which can provide imaging and sensing technologies not available through conventional technologies such as x-ray and microwave.

"The potential of THz wave remote sensing has been recognized for years, but practical application has been blocked by the fact that ambient moisture interferes with wave transmission," says Xi-Cheng Zhang, Ph.D., director of the Center for THz Research at Rensselaer.

Dr. Zhang, the J. Erik Jonsson Professor of Science at Rensselaer, is lead author of a paper to be published next week in the journal Nature Photonics. Titled "Broadband terahertz wave remote sensing using coherent manipulation of fluorescence from asymmetrically ionized gases," the paper describes the new system in detail.

The "all optical" technique for remote THz sensing uses laser induced fluorescence, essentially focusing two laser beams together into the air to remotely create a plasma that interacts with a generated THz wave. The plasma fluorescence carries information from a target material to a detector where it is instantly compared with material spectrum in the THz "library," making possible immediate identification of a target material.

"We have shown that you can focus a 800 nm laser beam and a 400 nm laser beam together into the air to remotely create a plasma interacting with the THz wave, and u
'/>"/>

Contact: Marshall Hoffman
marshall@hoffmanpr.com
703-533-3535
Rensselaer Polytechnic Institute
Source:Eurekalert

Page: 1 2

Related biology technology :

1. Revolutionary New In-Office EVOLVE(R) Laser Prostate Treatment Available Throughout Western Oregon
2. FDA Approves Orphan Drug Status for Revolutionary Cancer Drug for Children
3. Hong Kong Biotech Company, Filligent, Announces CE Certification of Its Revolutionary, Anti-Infective Medical Face Mask, the BioMask
4. BioNanomatrixs Revolutionary Whole Genome Analysis Platform Named to MIT Technology Reviews Annual 10 Emerging Technologies List
5. Z Therapy Is The First In North Texas To Offer Revolutionary Treatment Option For Neck Pain Sufferers
6. Accuri Cytometers Adds Automation to Its Revolutionary C6 Flow Cytometer(R) System With Commercial Launch of CSampler(TM)
7. ForteBio Launches Two Revolutionary High-Throughput, Label-Free Instruments: The Octet(R) RED384 and the Octet QK384
8. Microfluidics Introduces Revolutionary Bottom-up Technology as a Platform for Continuous Pharmaceutical Manufacturing
9. Microfluidics and POWREX Launch Revolutionary Continuous Pharmaceutical Manufacturing Technology in Japan
10. A revolutionary breakthrough in terahertz remote sensing
11. Stoppert Named as President and CEO at Breakthrough Renewable Technology Firm Segetis, Inc
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: