Navigation Links
"Brave New Reality" Provides a Wide Spectrum of High Tech News and Easy Science.
Date:7/1/2008

New website elevates curiosity and re-stimulates scientific interest through compelling stories at technology's leading edges. The latest science articles and expertise are available in the midst of a subdued background with simple tutorials and references. Selected books relevant to subject matter are offered to encourage further inquiry and study.

Tucson, AZ (PRWEB) July 1, 2008 -- BraveNewReality.com encourages visitors to embrace runaway technological progress and educate themselves by reading top science articles, interviews, books and vivid tutorials with lucid discussion and illustrations.

Keith Daniell, research engineer for 28 of years in the optics and semiconductor industry, has built a high tech website that is easy on the eyes and the brain. His goal is straightforward: keep people abreast of the latest goings on in high technology without feeling lost, frustrated or intimidated in the process; keep navigation uncluttered and predictable, with suitable backgrounds and a minimalist approach to information access.

The site affords visitors scientific know-how in at least four ways, making it stand out from a genre that, with few exceptions, tends to overwhelm with condensed information and technical terms:

1. Uses a combination of the latest science articles and informational aids. Experienced readers can dispense with the fundamentals and quickly access desired information. The less experienced visitors can find tutorials, links and references to navigate and follow through on the science content.

2. Provides an interface that does not tire the visual and thinking processes. The pages are clear from jam packed copy, multiple navigation bars and dynamic content. The focus is on steering intuitively to relevant information without too much distraction.

3. Supplies links to books and glossaries of immediate subject interest. P
'/>"/>

Source: PRWeb
Copyright©2008 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. CardioDynamics Provides 2007 Shareholder Meeting Update
2. Pressure BioSciences, Inc. Reports Second Quarter 2007 Financial Results and Provides Business Update
3. NxStage Medical Provides Update on Medisystems Acquisition
4. VaxGen Files 2006 Financial Statements and Provides Cash Update
5. Signalife Provides Corporate Update
6. Revolutionary Genomics Research Group Opens Boston Office; Provides DNA Evidence in Workers Comp Cases
7. Elekta Contract Provides Sisters of Mercy Health System Access to Leading Radiation Therapy Solutions
8. SGX Provides Update on BCR-ABL Collaboration
9. Intra-Cellular Therapies Provides Overview of its Proprietary Portfolio of Compounds for the Treatment of Female Sexual Dysfunction (FSD)
10. Pressure BioSciences, Inc. Provides Corporate Update
11. New Scrip Report Provides Strategic Insight on the Burgeoning Biosimilars Market
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... 19, 2014  Roche (SIX: RO, ROG; OTCQX: RHHBY) ... (Bina), a privately held company based in ... provides a big data platform for centralized management ... Bina,s proprietary on-market Genomic Management Solution, Bina-GMS 1 ... perform fast and scalable analyses to maximize the ...
(Date:12/19/2014)... Today, TiFiber, Inc. announced ... and future company headquarters in Fort Smith, Arkansas ... that safely and effectively control dangerous microorganisms. Fort ... historic, strong support for manufacturing, but also due ... technology-based companies such as TiFiber. , In ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)...   ISN has released its third annual ... publication series. With data aggregated from over eight ... within its online contractor management platform, ISNetworld, this three-part ... (KPI) statistics. The Contractor ... is available in two industry specific volumes: Oil ...
Breaking Biology Technology:Roche acquires Bina Technologies and enters the genomic informatics market 2Roche acquires Bina Technologies and enters the genomic informatics market 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 2Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 3Technology Company TiFiber™ to Establish Production Facility in Fort Smith, Arkansas with Support from Local Investors 4ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 2ISN Releases Third Edition of US Contractor Health & Safety Performance Indicators Publication Series 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: