Navigation Links
iCycler Thermal Cycler With 384-Well Reaction Module from Bio-Rad

ProductsiCycler Thermal Cycler With 384-Well Reaction Module from Bio-Rad
Company Bio-Rad
Item iCycler Thermal Cycler With 384-Well Reaction Module
Price 
Description The iCycler thermal cycler with 384-well reaction module is used for nucleic acid amplification (PCR) applications. It is equipped with an interchangeable, 384-well reaction module (5-20 microliter samples) and features algorithm temperature monitoring and control and ramp rates that are optimized for small sample volumes. It includes the iCycler base with 384-well reaction module, plates, sealing tape, power cord, quick reference card, and instructions. Dimensions are 26.4 x 54.6 x 23 cm.
Info Bio-RadBio-Rad
Bio-Rad Laboratories, Inc.
Life Science Research Group
2000 Alfred Nobel Drive
Hercules, CA 94547
USA
Customer Service: 800-424 6723
Fax Number: 800-879 2289
Web Site: http://discover.bio-rad.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. HC-3000 HybriCycler from UVP
2. MiniCycler thermal cycler from Bio-Rad
3. iCycler Thermal Cycler With 96 x 0.2 ml Reaction Module from Bio-Rad
4. Applied Biosystems 2720 Thermal Cycler from Applied Biosystems
5. iEMS Thermal Holder HT from Thermo Scientific
6. MBS Thermal Cycler 2 Block Laptop Kit from Thermo Scientific
7. MBS Satellite Thermal Cycler from Thermo Scientific
8. Robotic MBS Thermal Cycler 384 Well from Thermo Scientific
9. MBS Satellite Thermal Cycler 384 Well from Thermo Scientific
10. Robotic MBS Thermal Cycler 0.2 ml from Thermo Scientific
11. PxE Thermal Cycler 0.5ml from Thermo Scientific
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: