Navigation Links
Zero Blunt TOPO Kit for Sequencing with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli from Invitrogen

ProductsZero Blunt TOPO Kit for Sequencing with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli from Invitrogen
Company Invitrogen
Item Zero Blunt TOPO Kit for Sequencing with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli
Price 
Description The TOPO Cloning Kits for Sequencing allow 5-minute cloning and subsequent sequencing of PCR products. The kits contain TOPO Cloning vectors with primer sites located as close as 33 base pairs from the PCR product insertion site. This minimizes the amount of vector DNA that needs to be read before reaching the sequence of your insert.vectors are available. The pCR4-TOPO vector provides 3-T overhangs for direct ligation of Taq-amplified PCR products. The pCR4Blunt-TOPO vector provides blunt ends for cloning PCR products amplified with proofreading thermostable polymerases. Each vector is supplied linearized and topoisomerase I-activated enabling 5-minute bench-top ligation yielding recombinants (1). Both vectors feature:
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CopyRight pSMART VC Blunt Cloning Kit (with electrocompetent cells) from Lucigen
2. CopyRight pSMART VC Blunt Cloning Kit (without cells) from Lucigen
3. Zero Blunt TOPO PCR Cloning Kit with One Shot TOP10 Chemically Competent E. coli from Invitrogen
4. Zero Blunt TOPO PCR Cloning Kit with One Shot Mach1 T1 Phage-Resistant Chemically Competent E. coli from Invitrogen
5. HTP Zero Blunt TOPO PCR Cloning Kit for Sequencing MultiShot StripWell E. coli from Invitrogen
6. HTP Zero Blunt TOPO PCR Cloning Kit for Sequencing MultiShot E. coli from Invitrogen
7. Blunt-ended PCR Cloning Kit / pMOSBlue Competent Cells from GE Healthcare, formerly Amersham Biosciences
8. CopyRight pEZ BAC Blunt Cloning Kit (with electrocompetent cells) from Lucigen
9. CopyRight pEZ BAC Blunt Cloning Kit (without cells) from Lucigen
10. GeneRacer Kit with SuperScript II RT and Zero Blunt TOPO PCR Cloning kit for Sequencing from Invitrogen
11. Zero Blunt TOPO PCR Cloning Kit for Sequencing with One Shot TOP10 Electrocomp E. coli from Invitrogen
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:5/16/2017)... DALLAS , May 16, 2017   ... for health organizations, and MD EMR Systems ... certified development partner for GE, have established a ... Patient Portal product and the GE Centricity™ products, ... Centricity EMR. These new integrations ...
(Date:4/17/2017)... , April 17, 2017 NXT-ID, Inc. ... company, announces the filing of its 2016 Annual Report on Form ... Exchange Commission. ... Form 10-K is available in the Investor Relations section of the ... on the SEC,s website at http://www.sec.gov . 2016 ...
(Date:4/11/2017)... , April 11, 2017 No two ... researchers at the New York University Tandon School ... Engineering have found that partial similarities between prints ... used in mobile phones and other electronic devices ... The vulnerability lies in the fact that ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... As Ebola resurfaces in the Democratic ... suspected cases now reported, a new analysis of the Ebola ... correlation between the 2014 and 2017 outbreaks of the disease.  ... 2012-13, which preceded the 2014 outbreak. An analysis of the ... counts in 2014-15, which again precedes the current outbreak in ...
(Date:5/23/2017)... , ... May 22, 2017 , ... ... in a row in the Aragon Research Globe™ for Corporate Learning, 2017. , ... industry direction and market demand, and effectively perform against those strategies. NetDimensions’ ranking ...
(Date:5/23/2017)... (PRWEB) , ... May 23, 2017 , ... Bacterial biofilms, ... polymeric molecules, can cause diverse pathologies ranging from food poisoning and catheter infections to ... biofilms is in the tens of billions of dollars per year, there is currently ...
(Date:5/22/2017)... ... 2017 , ... Cancer diagnostics and pathology workflow solution provider ... Association for Pathology Informatics Annual Summit at the Wyndham Grand Hotel ... Diagnostic Cockpit and Consultation Portal, Inspirata will present research it led to help ...
Breaking Biology Technology: