Navigation Links
X-Gal/IPTG Solution from Bioline

ProductsX-Gal/IPTG Solution from Bioline
Company Bioline
Item X-Gal/IPTG Solution
Price $55.00
Description Ready-to-use; 40mg/ml X-Gal and 32mg/ml IPTG
Info BiolineBioline
Bioline USA Inc.
28 South Main St., PMB 311
Randolph, MA 02368-4800

Call Bioline to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-453-8629
Customer Service: 888-257-5155
Fax Number: 781-830-0205
Web Site: http://www.bioline.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. AAIBiotech Solutions from AAIPharma Inc.
2. NeuroCyte - Rat Neural Stem Cell Kit from Orion BioSolutions, Inc.
3. Alsevers Solution from Sigma-Aldrich
4. Tyrodes Solution, Acidic from Sigma-Aldrich
5. Geys Balanced Salt Solution (GBSS) from Sigma-Aldrich
6. Cartesian Honeybee System for protein crystallization from Genomic Solutions
7. Earles Balanced Salt Solution, 10x (EBSS) from Sigma-Aldrich
8. Hummingbird for Compound Library Management from Genomic Solutions
9. BSA 10% Solution in Iscoves MDM, 100 mL from StemCell Technologies, Inc.
10. Product Quotation Request - Microarray Spotting Solution for Silane Coated Slides from Sigma-Aldrich
11. 50X Denhardts Solution from Invitrogen
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... polyclonal antibody raised against a ... Immunogen: PPP4C (NP_002711, ... partial recombinant protein with GST ... Number: NM_002720 ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:7/10/2020)... ... July 08, 2020 , ... Overcoming Comparability Issues in ... FDAnews Webinar, Wednesday, July 22, 2020 • 1:30 p.m.-3:00 p.m. EDT, https://www.fdanews.com/cellandgenetherapy ... most effective way to complete one? Will the study comply with all FDA ...
(Date:7/4/2020)... ... July 03, 2020 , ... ... outstanding recognition and multiple awards for not only the products and treatments developed, ... Skincare and Vivace® Microneedle RF. All the brands built by ABM have received ...
(Date:7/2/2020)... ... July 02, 2020 , ... ... B.V. (MBS) has announced a publication detailing the use of its revolutionary ... polymerase chain reaction (RT-PCR) in 16 minutes. The article, titled "Ultra-fast one-step ...
Breaking Biology News(10 mins):
(Date:8/3/2020)... ... August 03, 2020 , ... ... announced Jim Corrigan, President and CEO has been named one of the 100 ... of industry sectors, PharmaVoice 100 honorees are selected based on how they have ...
(Date:7/31/2020)... ... July 29, 2020 , ... R3 Stem Cell International is now ... With 50 million stem cells total, patients may choose which extremities they would like ... arthritic joints (BMC Musculoskelet Disord. 2016). At R3 International, umbilical cord tissue is obtained ...
(Date:7/31/2020)... ... July 29, 2020 , ... Diversified Technologies, ... that can be configured to drive Klystrons, TWTs, IOTs, and magnetrons. , ... or two switches in a push-pull configuration; yielding fast fall time for a ...
(Date:7/31/2020)... , ... July 29, 2020 , ... ... Catalent, the leading global provider of advanced delivery technologies, development, and manufacturing solutions ... that they have entered into a strategic partnership whereby Catalent will provide support ...
Breaking Biology Technology: