Navigation Links
WR CRYETTE from Precision Systems, Inc.

ProductsWR CRYETTE from Precision Systems, Inc.
Company Precision Systems, Inc.
Item WR CRYETTE
Price 
Description Wide Range CRYETTE WR Cryoscope for molecular weight determinations for petroleum-based applications. Multiple solvents can be used, such as water, benzene, formamide, nitrobenzene, cyclohexane, 1,4-dioxane, p-xylene, dimethyl sulfoxide, freon 112, cyclohexanol, sulfolane.

* Range: 12-position switchable:
* -10.0 C to +10.0 C
* Dimensions: 10"H x 15"W x 9"D
* Weight: 22 lbs.

Info Precision Systems, Inc.Precision Systems, Inc.
16 Tech Circle
Natick, MA 01760

Call Precision Systems, Inc. to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-508-318-5169
Customer Service: 508-655-7010
Fax Number: 508-653-6999
Web Site: http://www.precisionsystemsinc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. PB3002-S/FACT DeltaRange Precision Balance from Mettler Toledo, Inc.
2. PL1501-S Precision Balance from Mettler Toledo, Inc.
3. LX80 Series Precision Stages from Parker Hannifin Corporation
4. Precision XS Microplate Sample Processor from BioTek Instruments
5. MX80 Series Miniature Precision Stages from Parker Hannifin Corporation
6. XRS Series Precision Linear Tables from Parker Hannifin Corporation
7. Multi-OSMETTE from Precision Systems, Inc.
8. Micro-OSMETTE from Precision Systems, Inc.
9. ANALETTE II from Precision Systems, Inc.
10. OSMETTE XL from Precision Systems, Inc.
11. OSMETTE III from Precision Systems, Inc.
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/23/2017)... Maryland (PRWEB) , ... February ... ... PathSensors, Inc., announced today that in a published evaluation of multiple immunoassay-based ... a U.S. Department of Energy Laboratory, PathSensors’ CANARY® biosensor threat detection technology ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... Therapeutics, Inc. (NASDAQ: PETX), a pet therapeutics company focused on ... companion animals, will host a live conference call on Tuesday, ... results from the fourth quarter and full year ended December ... access the audio webcast or use the conference ... ...
(Date:2/22/2017)... Scientists propose in Nature blocking ... Gaucher and maybe other lysosomal storage diseases as a ... current therapies. An international research team led ... also included investigators from the University of Lübeck in ... 22. The study was conducted in mouse models of ...
Breaking Biology Technology: