Navigation Links
Vivaspin 2 (10,000 MWCO Hydrosart) from Sartorius AG

ProductsVivaspin 2 (10,000 MWCO Hydrosart) from Sartorius AG
Company Sartorius AG
Item Vivaspin 2 (10,000 MWCO Hydrosart)
Price 
Description The new Vivaspin 2 bridges the gap between the 500 l and 4 ml centrifugal concentrators. This device combines the speed of the classic Vivaspin products with low internal surface and membrane area for superior recoveries from very dilute solutions.

Available with a choice of PES, Cellulose Triacetate membranes, Vivaspin 2 offers the highest flexibility for process optimisation.

Also unique to the Vivaspin 2, is the choice of directly pipetting the concentrate from the dead stop pocket built into the bottom of the concentrator, or alternatively reverse spinning into the concentrate recovery cap which can then be sealed for storage.

Info Sartorius AGSartorius AG
Weender Landstrasse 94-108
D-37075 Goettingen, Germany
Phone: +49.551.308.0
Fax: +49.551.308.3289

Sartorius North America, Inc.
Biolab - Biotechnology Division
131 Heartland Blvd.
Edgewood, NY 11717
USA
Toll-free: 877-452-2345
Fax: 631-253-5460


Customer Service: +49.551.308.0
Fax Number: +49.551.308.3289
Web Site: http://www.sartorius.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. VoluPAC Tubes from Sartorius AG
2. CERTOMAT IS from Sartorius AG
3. Vivaclear Centrifugal Filters from Sartorius AG
4. CERTOMAT RM from Sartorius AG
5. CERTOMAT U from Sartorius AG
6. Sartolab P 20 Disposable Pressure Filter, 0.2 m, sterile, single packed from Sartorius AG
7. CERTOMAT R from Sartorius AG
8. Microsart e.motion Membrane Filters from Sartorius AG
9. Microsart e.motion Membrane Filters from Sartorius AG
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products:
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
(Date:8/28/2014)... -- Next month, executives from clinical trial marketing firm BBK Worldwide ... Patient-Centered Clinical Trials 2014 , to be held at ... September 4-5. Patient recruitment experts Bonnie A. Brescia , ... share insights on the benefits of employing an effective patient ... media to mobile apps – can be used to drive ...
(Date:8/28/2014)... 28, 2014  Armetheon, Inc. ( www.armetheon.com ), ... to late-stage cardiovascular drug candidates, today announced that ... round of financing. The Series A round was ... with participation from investors that included Atheneos Capital ... Larry Hsu , the founder of Impax ...
(Date:8/28/2014)... Vt. (PRWEB) August 28, 2014 ... testing around the world is available from Strategic ... diagnostics companies. “ Industrial Microbiology Market Review, Fourth ... Industrial Market ” (IMMR—4) tracks and compares microbiology ... in North America, Europe and Asia, and forecasts ...
(Date:8/28/2014)... San Diego, CA (PRWEB) August 28, 2014 ... products, Pipette.com is offering a promotion for ... enables Pipette.com customers to purchase the highest quality ... Centrifuge Tubes are ideal for customers doing chemical, ... benefit lab technicians who are not regularly able ...
Breaking Biology Technology:BBK Worldwide Leads Sessions at Key September Events 2Armetheon Completes $7.0 Million Series A Financing 2Armetheon Completes $7.0 Million Series A Financing 32 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 22 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 3Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 2Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 3