Navigation Links
Upright Freezer Racks for Standard 3" Boxes from LABREPCO, Inc.

ProductsUpright Freezer Racks for Standard 3" Boxes from LABREPCO, Inc.
Company LABREPCO, Inc.
Item Upright Freezer Racks for Standard 3" Boxes
Price 
Description Upright Freezer Inventory Storage Racks for Standard 3" Boxes. Various configurations available to fit all makes and models of upright freezers and refrigerators. Made of high quality stainless steel and can accommodate standard 3" high fiberboard, stainless steel or plastic boxes. Custom shapes and sizes of racks are available upon request.
Info LABREPCO, Inc.LABREPCO, Inc.
101 Witmer Road, Suite 700 Horsham, PA 19044

Call LABREPCO, Inc. to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-532-1810
Customer Service: 877-522-7372
Fax Number: 215-442-9202
Web Site: http://www.labrepco.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. LN2 Backup, Factory Installed, All Voltages, for 3.0 and 6.7 cu ft -86C Chest Freezers & all -40C/ -86C Upright Freezers from Thermo Scientific
2. Deluxe CO2 Backup, Factory Installed, All Voltages, for 3.0 and 6.7 cu ft -86C Chest Freezers & all -40C/ -86C Upright Freezers from Thermo Scientific
3. Top and Front Access CryoMed Freezer, LN2, Integrated Control and 4" Printer, IVF, 1.2 cu ft, 120V, 60 Hz from Thermo Scientific
4. Freezerworks Unlimited 2.0 - Network Client/Server from Dataworks Development
5. White 2" Freezer Storage Boxes With 10 x 10 Grid from PGC Scientifics
6. White 2" Freezer Storage Boxes With 9 x 9 Grid from PGC Scientifics
7. Portable LN2 Storage Container, 110 Liter (includes four 4000558 Racks) from Thermo Scientific
8. 2 ml SmartScan Racks from ABgene
9. 384 Cluster Tube Racks from ABgene
10. Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
11. Standard DNA Aptamer Microarray from LC Sciences
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products:
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2