Navigation Links
UltraLink Immobilized NeutrAvidin from Pierce Biotechnology, Inc.

ProductsUltraLink Immobilized NeutrAvidin from Pierce Biotechnology, Inc.
Company Pierce Biotechnology, Inc.
Item UltraLink Immobilized NeutrAvidin
Description When nonspecific binding is a problem in your application, Pierce offers a variety of immobilized NeutrAvidin products as superior alternatives to avidin or streptavidin. NeutrAvidin is a modified avidin derivative that combines several key features to provide a biotin-binding protein with exceptionally low nonspecific binding properties. NeutrAvidin does not contain carbohydrate and has an ideal isoelectric point (6.3) for the best utility in a variety of applications.

For assay development, Pierce has coated NeutrAvidin onto microplates and pre-blocked the plastic surface. Any biotinylated compound can now be attached to the plate and analyzed further. Proteins will retain their structural integrity when bound to a protein instead of bound directly to a plastic surface. The plastic surface may distort the structure of the proteins and prevent accurate detection of the ligand in the assay system. Binding biotinylated compounds to NeutrAvidin provides a stable anchor to the plastic surface.

  • Immunoprecipitation
  • Binding Biotinylated DNA to coated plates
  • Purifying proteins that bind to biotinylated ligands
  • Carbohydrate Free - Just like streptavidin, NeutrAvidin has no carbohydrate, eliminating nonspecific binding problems due to sugars.
  • No interaction with cell surface molecules - absence of the Arg-Tyr-Asp sequence (present in streptavidin), which mimics the universal cell surface recognition sequence present in a variety of molecules, eliminates cross-reactivity of cell surface molecules.
  • Easily conjugated - Most modified avidins have lysines that are unavailable for coupling. NeutrAvidin's unique preparation preserves lysines, making conjugations easier.
  • Neutral pI - With a pI of 6.3, NeutrAvidin's pI is closer to neutrality than avidin or streptavidin. This eliminates electrostatic interaction which contributes to nonspecific binding.
Less nonspecific binding produces better results and better yields.
Info Pierce Biotechnology, Inc.Pierce Biotechnology, Inc.
Pierce Biotechnology, Inc.
3747 N. Meridian Rd.
P.O. Box 117
Rockford, IL 61105
Customer Service: 815-968-0747
Fax Number: 815-968-8148
Web Site:
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Immobilized Metal affinity ProteinChip Arrays from Ciphergen
2. Immobilized E. coli Lysate from Pierce Biotechnology, Inc.
3. Modern Protein Chemistry: Practical Aspects from Pierce Biotechnology, Inc.
4. Protein-Protein Interactions, from Pierce Biotechnology, Inc.
5. Imject Freunds Complete Adjuvant (FCA) from Pierce Biotechnology, Inc.
6. Imject Freunds Incomplete Adjuvant (FIA) from Pierce Biotechnology, Inc.
7. Extracti-Gel D Detergent Removing Gel AffinityPak Columns from Pierce Biotechnology, Inc.
8. GUIDE TO PROTEIN PURIFICA from Pierce Biotechnology, Inc.
9. PROTEIN PROTOCOLS Book from Pierce Biotechnology, Inc.
10. Product Information Request - SuperSignal West Pico COMPLETE Biotinylated Protein Detection Kit from Pierce Biotechnology, Inc.
11. DISCOVERLIGHT RABBIT ARRA from Pierce Biotechnology, Inc.
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... ... October 11, 2017 , ... Personal eye wash is a basic first aid supply for any ... So which eye do you rinse first if a dangerous substance enters both eyes? It’s ... Wash with its unique dual eye piece. , “Whether its dirt and debris, or ...
(Date:10/11/2017)... BioMarketing, a leading provider of patient support solutions, has announced ... network, which will launch this week. The VMS CNEs will ... to enhance the patient care experience by delivering peer-to-peer education ... professionals to help women who have been diagnosed and are ... ...
(Date:10/11/2017)... ... 11, 2017 , ... A new study published in Fertility ... fresh in vitro fertilization (IVF) transfer cycles. The multi-center matched cohort ... After comparing the results from the fresh and frozen transfer cohorts, the authors ...
Breaking Biology Technology: