Navigation Links
UCB MoDC Cell Chip-IHC from 3H Biomedical AB

ProductsUCB MoDC Cell Chip-IHC from 3H Biomedical AB
Company 3H Biomedical AB
Item UCB MoDC Cell Chip-IHC
Price $599.00
Description Monocyte-derived dendritic cells, For immunohistochemistry (IHC)

Cell Chip with Human Umbilical Cord Blood Dendritic Cells
Info 3H Biomedical AB3H Biomedical AB
Dag Hammarskjlds vg 34,
House Generalen, Uppsala Science Park
751 83 Uppsala
Sweden
Customer Service: (+46) 018-504400
Web Site: http://www.3hbiomedical.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. UCB Neutrophil Chip-IHC from 3H Biomedical AB
2. MoDC Cell Chip-IHC from 3H Biomedical AB
3. UCB PDC Cell Chip-IHC from 3H Biomedical AB
4. EPC Cell Chip-IHC from 3H Biomedical AB
5. NK Cell Chip-IHC from 3H Biomedical AB
6. Monocyte Cell Chip-IHC from 3H Biomedical AB
7. UCB CD4 T Cell Chip-IHC from 3H Biomedical AB
8. Neutrophil Chip-IHC from 3H Biomedical AB
9. CD8 T Cell Chip-IHC from 3H Biomedical AB
10. UCB B Cell Chip-IHC from 3H Biomedical AB
11. UCB Basophil Chip-IHC from 3H Biomedical AB
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial ... (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant ... Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: ... AAH15528 OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products:
(Date:3/30/2017)... 30, 2017  On April 6-7, 2017, Sequencing.com will ... hackathon at Microsoft,s headquarters in ... focus on developing health and wellness apps that provide ... the Genome is the first hackathon for personal ... largest companies in the genomics, tech and health industries ...
(Date:3/30/2017)... -- Trends, opportunities and forecast in this market to ... AFIS, iris recognition, facial recognition, hand geometry, vein recognition, ... industry (government and law enforcement, commercial and retail, health ... and by region ( North America , ... , and the Rest of the World) ...
(Date:3/28/2017)... -- The report "Video Surveillance Market by ... Devices), Software (Video Analytics, VMS), and Service (VSaaS, Installation ... 2022", published by MarketsandMarkets, the market was valued at ... reach USD 75.64 Billion by 2022, at a CAGR ... considered for the study is 2016 and the forecast ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... ... August 15, 2017 , ... JULABO USA introduces ... the new website makes it easy to navigate through the site whether you’re ... find detailed product information, educational industry content and visit the company’s social media ...
(Date:8/11/2017)... San Antonio, Texas (PRWEB) , ... August 11, 2017 , ... ... launching a rebranding campaign this month that will incorporate important key elements including a ... to thank the community that has supported them, Bill Miller has partnered with the ...
(Date:8/10/2017)... ... 09, 2017 , ... The era of using extracellular vesicles ... team at Capricor Therapeutics, Inc. utilized a cardiosphere-derived stem-like cell culturing process to ... Travis Antes, head of analytical development at Capricor Therapeutics Inc., will be the ...
(Date:8/10/2017)... ... August 10, 2017 , ... ... Kinokuniya Company Ltd. as its exclusive sales representative for SPIE Journals in Japan. ... the SPIE Digital Library in Japan. , “We look forward to expanding our ...
Breaking Biology Technology: