Navigation Links
UCB EPC Cell Chip-IHC from 3H Biomedical AB

ProductsUCB EPC Cell Chip-IHC from 3H Biomedical AB
Company 3H Biomedical AB
Item UCB EPC Cell Chip-IHC
Price $799.00
Description Cord blood endothelial progenitor cells, For immunohistochemistry (IHC)

Cell Chip with Human Umbilical Cord Blood Progenitor Cells
Info 3H Biomedical AB3H Biomedical AB
Dag Hammarskjlds vg 34,
House Generalen, Uppsala Science Park
751 83 Uppsala
Sweden
Customer Service: (+46) 018-504400
Web Site: http://www.3hbiomedical.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. UCB Neutrophil Chip-IHC from 3H Biomedical AB
2. MoDC Cell Chip-IHC from 3H Biomedical AB
3. UCB PDC Cell Chip-IHC from 3H Biomedical AB
4. EPC Cell Chip-IHC from 3H Biomedical AB
5. NK Cell Chip-IHC from 3H Biomedical AB
6. Monocyte Cell Chip-IHC from 3H Biomedical AB
7. UCB CD4 T Cell Chip-IHC from 3H Biomedical AB
8. Neutrophil Chip-IHC from 3H Biomedical AB
9. CD8 T Cell Chip-IHC from 3H Biomedical AB
10. UCB B Cell Chip-IHC from 3H Biomedical AB
11. UCB Basophil Chip-IHC from 3H Biomedical AB
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:4/15/2016)... , April 15, 2016  A new ... make more accurate underwriting decisions in a fraction ... timely, competitively priced and high-value life insurance policies ... screenings. With Force Diagnostics, rapid testing ... lifestyle data readings (blood pressure, weight, pulse, BMI, ...
(Date:3/31/2016)... BOCA RATON, Florida , March 31, 2016 /PRNewswire/ ... LEGX ) ("LegacyXChange" or the "Company") ... presentation for potential users of its soon to be ... The video ( https://www.youtube.com/channel/UCyTLBzmZogV1y2D6bDkBX5g ) will also ... by the use of DNA technology to an industry ...
(Date:3/22/2016)... PUNE, India , March 22, 2016 ... new market research report "Electronic Sensors Market for ... Fingerprint, Proximity, & Others), Application (Communication & ... and Geography - Global Forecast to 2022", ... consumer industry is expected to reach USD ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... ... June 27, 2016 , ... Rolf K. Hoffmann, former ... of the University of North Carolina Kenan-Flagler Business School effective June ... UNC Kenan-Flagler, with a focus on the school’s international efforts, leading classes and ...
(Date:6/24/2016)... Brooklyn, NY (PRWEB) , ... June 24, 2016 , ... ... 15mm, machines such as the Cary 5000 and the 6000i models are higher end ... height is the height of the spectrophotometer’s light beam from the bottom of the ...
(Date:6/23/2016)... 2016 /PRNewswire/ - FACIT has announced the creation ... biotechnology company, Propellon Therapeutics Inc. ("Propellon" or "the ... a portfolio of first-in-class WDR5 inhibitors for the ... WDR5 represent an exciting class of therapies, possessing ... for cancer patients. Substantial advances have been achieved ...
(Date:6/23/2016)... , June, 23, 2016  The Biodesign Challenge (BDC), ... new ways to harness living systems and biotechnology, announced ... (MoMA) in New York City . ... participating students, showcased projects at MoMA,s Celeste Bartos Theater ... Antonelli , MoMA,s senior curator of architecture and design, ...
Breaking Biology Technology: