Navigation Links
T4 DNA Polymerase from Roche Applied Science

ProductsT4 DNA Polymerase from Roche Applied Science
Company Roche Applied Science
Item T4 DNA Polymerase
Price 
Description Request Info
Info Roche Applied ScienceRoche Applied Science
Roche Diagnostics Corporation
P.O. Box 50414
9115 Hague Road
Indianapolis, IN 46250-0414 USA




Call Roche Applied Science to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-346-8242
Customer Service: 800-262-1640
Tech Support: 800-262-4911
Fax Number: 800-428-2883
Web Site: http://www.roche-applied-science.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. T4 DNA Polymerase from Roche Applied Science
2. Poly A Polymerase from Invitrogen
3. iTaq DNA Polymerase, 250 U from Bio-Rad
4. iTaq DNA Polymerase, 5,000 U from Bio-Rad
5. Taq DNA Polymerase, 500 U (2 x 250 U) without dNTP from Bioneer, Inc.
6. T4 DNA Polymerase from Invitrogen
7. T4 DNA Polymerase from New England Biolabs
8. SP6 RNA Polymerase from Roche Applied Science
9. Taq DNA Polymerase (cloned) from GE Healthcare, formerly Amersham Biosciences
10. Mango-Taq DNA Polymerase from Bioline
11. AmpliTaq Gold DNA Polymerase from Applied Biosystems
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:3/22/2017)... , March 21, 2017 ... Cloud used by retailers such as 1-800-Flowers and ... platform — Product Recommendations and Replenishment. Using Optimove,s machine ... more personalized product and replenishment recommendations to their ... also on predictions of customer intent drawn from ...
(Date:3/20/2017)... ALLENTOWN, Pa. , March 20, 2017 ... PD 2.0 personal spirometer and Wellness Management System (WMS), ... Founded in 2010, PMD Healthcare is a ... Company with a mission dedicated to creating innovative solutions ... of life. With that intent focus, PMD developed the ...
(Date:3/9/2017)... , March 9, 2017 4Dx has publicly ... Lung Imaging Workshop at the University of Pennsylvania. Founder ... to deliver the latest data to world leaders in ... brings together leaders at the forefront of the industry ... imaging. "The quality of the imaging ...
Breaking Biology News(10 mins):
(Date:5/23/2017)... ... May 23, 2017 , ... Cambridge Semantics , the leading provider of ... Bio-IT World Conference and Expo in Boston May 23-25 with a featured speaker ... Anzo Smart Data Lake is also a finalist for the Best of Show award. ...
(Date:5/22/2017)... PA (PRWEB) , ... May 22, 2017 , ... ... announced today that it is exhibiting in booth B2 at the Association for ... Pittsburgh, May 22-25. , In addition to demonstrating its Cancer Diagnostic Cockpit ...
(Date:5/19/2017)... (PRWEB) , ... May 19, 2017 , ... ... QED Proof-of-Concept Program. Academic researchers with technologies ripe for commercialization, and who ... Jersey and Delaware, are encouraged to submit proposals. QED, now in its tenth ...
(Date:5/18/2017)... ... ... NDA Partners Chairman Carl Peck, MD , announced today that Richard Kenley, ... Pharmaceutical Development Business Unit of Cardinal Health, has joined the firm as an Expert ... Chief Operating Officer at Anaborex, Senior VP and General Manager of the San Diego ...
Breaking Biology Technology: