Navigation Links
TNT SP6 Coupled Reticulocyte Lysate System, Trial Size from Promega

ProductsTNT SP6 Coupled Reticulocyte Lysate System, Trial Size from Promega
Company Promega
Item TNT SP6 Coupled Reticulocyte Lysate System, Trial Size
Price Inquire
Description The TNT Coupled Reticulocyte Lysate Systems(a,b,c,d) offer researchers an alternative for eukaryotic in vitro translations: a single-tube, coupled transcription/translation system. The TNT Lysate Systems greatly simplify the process and reduce the time required to obtain in vitro translation results. Standard rabbit reticulocyte lysate translations (1) commonly use RNA synthesized in vitro (2) from SP6, T3 or T7 RNA polymerase promoters and require three separate reactions with several steps between each reaction. The TNT Systems bypass many of these steps by incorporating transcription directly in the translation mix.
Info PromegaPromega
2800 Woods Hollow Rd.
Madison, WI 53711-5399 USA
Customer Service: 800-356-9526
Tech Support: 1-800-356-9526
Fax Number: 800-356-1970
Web Site: http://www.promega.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. TNT T7 Coupled Wheat Germ Extract System from Promega
2. TNT® T7 Quick Coupled Transcription/Translation System from Promega
3. G-Protein Coupled Receptor Assay from GE Healthcare, formerly Amersham Biosciences
4. Flexi Rabbit Reticulocyte Lysate System from Promega
5. Rabbit Reticulocyte Lysate, Untreated from Promega
6. ChemiArray Mouse Lysate Angiogenesis Antibody Array I , 25 cytokines per membrane from CHEMICON
7. Immobilized E. coli Lysate from Pierce Biotechnology, Inc.
8. RAW 309 Cr.1 Cell Lysate from Santa Cruz Biotechnology, Inc.
9. EDG-6 Lysate from Exalpha Biologicals, Inc.
10. ChemiArray Mouse Lysate Atherosclerosis Antibody Array I, 20 cytokines per membrane from CHEMICON
11. ChemiArray Mouse Lysate Cytokine Antibody Array III, 62 cytokines per membrane from CHEMICON
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:2/13/2020)... ... February 13, 2020 , ... ... with Nobio CEO Yoram Ashery to discuss how their revolutionary technology ... that combats bacteria to keep people healthy with their revolutionary nanoparticle technology. Nobio ...
(Date:2/10/2020)... ... 2020 , ... A Worcester Polytechnic Institute (WPI) bioinformatics researcher ... a major development that potentially holds the key to understanding the spread and ... the Wuhan coronavirus made available on the National Center for Biotechnology Information ...
(Date:2/5/2020)... ... February 04, 2020 , ... Crystal Diagnostics (CDx) ... a second patent related to proprietary liquid crystal technology for rapid and accurate ... the USPTO issued on December 3, 2019. Together, these patents protect the company’s ...
Breaking Biology News(10 mins):
(Date:2/19/2020)... ... February 18, 2020 , ... ... characterizing microbiome populations down to the strain level, recently unveiled a novel DNA ... for efficient and unbiased isolation of high molecular weight (HMW) single-stranded DNA (ssDNA) ...
(Date:2/19/2020)... ... February 19, 2020 , ... Red ... life sciences industry, today announced the opening of a new office in Tokyo, ... Nucleus R&D. , Red Nucleus announced the new office in response to customer ...
(Date:2/11/2020)... ... February 11, 2020 , ... ... announce the successful results from a long-term follow-up clinical study of outpatient ... fixation device (INSPAN LLC). Unlike extension block design, the Inspan device fixates ...
(Date:2/10/2020)... , ... February 10, 2020 , ... R3 Medical Training ... March 13-14th, 2020 in Las Vegas. The course is hands on involving real ... For the past few years, the Comprehensive Stem Cell Training Course has received rave ...
Breaking Biology Technology: