Navigation Links
Standard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences

ProductsStandard Protein Kinase Substrate (PKS) Peptide Microarray from LC Sciences
Company LC Sciences
Item Standard Protein Kinase Substrate (PKS) Peptide Microarray
Description Microarrays designed for proteomic scale kinase profiling, quantitative measurement of kinase kinetic activities, and drug discovery research built on the flexible and powerful Paraflo microfluidic on-chip synthesis platform. These microarrays are available as part of our comprehensive Protein Kinase Substrate - Peptide Microarray Service.

Probe Content
Our standard content PKS peptide microarray includes a comprehensive list of kinases and their related experimentally verified Serine, Threonine, and Tyrosine phosphorylation sites compiled from the Phospho.ELM database. Customization of standard arrays is permitted.

High-Throughput Format
Traditional kinase assays focus on a single to a few peptide or protein substrates. Profiling kinases on a peptide microarray offers the opportunity to study thousands of specific substrates in a single experiment. One experiment using our protein kinase substrate (PKS) - peptide microarray is equivalent to 40 or more experiments using a 96-well plate.

Paraflo Technology
These are not spotted arrays. The Paraflo microfluidic technology enables on-chip synthesis ensuring high probe quality, tight process control, and complete content flexibility. In addition, the microfluidic technology produces a uniform distribution of the sample solutions on the array and enhances binding reactions and stringency wash processes.

Quantitative Results
Well designed positive and negative controls as well as a universal highly phosphate-specific fluorescent dye staining reagent ensure quantitative results. There is no need for radioisotope labeling and potential signal bias due to antibody sequence specificity is eliminated. Test sequence signals can be directly compared to phosphopeptide signals (considered to be 100% of phosphorylation reading).

LC Sciences
LC Sciences is a genomics and proteomics company offering innovative, customizable, and comprehensive microarray services for nucleic acid/protein profiling and functional analysis, biomarker-discovery, novel drug screening, and the custom development of diagnostic devices. We provide unique one-stop products and services for assays of DNA, RNA, protein, enzymes, antibodies, or small molecules, as well as proven microfluidic technology and novel microarray chemistry for design of your miniaturized assay devices for diagnostics and biosensing applications.

Our microarray services include the use of custom synthesized microarrays based on the Paraflo on-chip synthesis technology which enables the total customization of content on each individual microarray. Our customers have the flexibility to use our standard probe content or their own custom designed probe content and to use probes of their chosen lengths and number of replicates. The Paraflo technology also provides the flexibility of synthesizing microarrays containing probes with modifications such as, 5-amino linker, phosphate, biotin, and various methylation or other types of modifications. Incorporation of modifications greatly increases the number of applications for these microarrays.

LC Sciences offers additional Paraflo technology derived products that serve customers needs for construction of biomolecular libraries containing up to millions of different biomolecules of defined sequences. These products significantly reduce the cost and increase the speed of highly multiplexing genome-scale experiments such as exploration of small RNAs and designer gene/DNA library synthesis.
Info LC SciencesLC Sciences
2575 W. Bellfort
Suite 270
Houston, TX 77054

Call LC Sciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-713-574-7399
Customer Service: (713) 664-7087 or Toll Free: (888) 528-8818
Fax Number: (713) 664-8181
Web Site:
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Standard DNA Aptamer Microarray from LC Sciences
2. Standard 2-F RNA Aptamer Microarray from LC Sciences
3. Standard 2-OMe RNA Aptamer Microarray from LC Sciences
4. Illumina Standard Data Analysis Report from Asuragen, Inc.
5. Affymetrix Standard Data Analysis Report from Asuragen, Inc.
6. Organic Acid Analysis Standard, 6 vials from Bio-Rad
7. Carbohydrate Analysis Standard, 6 vials from Bio-Rad
8. ICS-1500 Standard Integrated IC System from Dionex Corporation
9. GeneChoice Taq DNA Polymerase With Standard Buffer from GeneChoice, Inc.
10. GeneChoice Taq DNA Polymerase With Magnesium Free Standard Buffer from GeneChoice, Inc.
11. Standard Beacon 2000 U.S. Extended Warranty (1 year) from Invitrogen
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: