Navigation Links
SkanIt Software for Varioskan, Drug Discovery Edition from Thermo Scientific

ProductsSkanIt Software for Varioskan, Drug Discovery Edition from Thermo Scientific
Company Thermo Scientific
Item SkanIt Software for Varioskan, Drug Discovery Edition
Price 
Description SkanIt™ Software is the ultimate tool for both microplate reader control and data handling. There are two editions of SkanIt Software available; a Research Edition for scientists working in life science research, and a Drug Discovery Edition offering features needed for compliance with FDA's 21 CFR Part 11, for the drug discovery industry.
Info Thermo ScientificThermo Scientific
450 Fortune Blvd.
Milford, MA 01757
Customer Service: North America: 1-877-THERMO-U
Fax Number: 508-520-2229
Web Site: http://www.thermo.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. LabX Light Balance Software from Mettler Toledo, Inc.
2. LabX Pro Balance Software from Mettler Toledo, Inc.
3. Noninvasive Blood Pressure Software from IITC Life Science
4. ProteinPilot Software from Applied Biosystems
5. PerkinElmer Spectrum Beers Law QUANT Quantitative Software, CD from PerkinElmer
6. PerkinElmer Spectrum Beers Law QUANT Quantitative Software, Floppy Disk from PerkinElmer
7. GenePix Pro Microarray Image Analysis Software from Molecular Devices
8. Acuity Enterprise Microarray Informatics Software from Molecular Devices
9. IRsolution Software from Shimadzu
10. KODAK Molecular Imaging Software Regulator Edition from Molecular Imaging Systems, Carestream Health, Inc. (formerly Kodak Molecular Imaging Systems)
11. SigmaStat 3.5 from Systat Software, Inc
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/23/2017)... TORONTO , Feb. 23, 2017 /PRNewswire/ - The ... Institute for Cancer Research (OICR) are pleased to report ... Series A financing, with Johnson & Johnson Innovation – ... investors include venture groups HealthCap, TPG Biotechnology Partners, and ... ...
(Date:2/23/2017)... Antonio, TX (PRWEB) , ... February 23, 2017 ... ... Drug Administration (FDA) de novo clearance to begin marketing the SPEAC® System, the ... indicated for adults at home or in healthcare facilities during periods of rest. ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... ... February 22, 2017 , ... Kernel ... Kendall Research Systems, LLC (KRS) clinical development program. KRS is a neurotechnology ... for research and clinical applications. The terms of the transaction were not disclosed. ...
Breaking Biology Technology: