Navigation Links
Sheep Anti-Human CORTISOL BINDING GLOBULIN Polyclonal Antibody, Unconjugated from AbD Serotec

ProductsSheep Anti-Human CORTISOL BINDING GLOBULIN Polyclonal Antibody, Unconjugated from AbD Serotec
Company AbD Serotec
Item Sheep Anti-Human CORTISOL BINDING GLOBULIN Polyclonal Antibody, Unconjugated
Price $160.00
Description ANTI CORTIS BIN GLOB
Info AbD SerotecAbD Serotec

UK & Ireland
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

North & South America
MorphoSys US Inc
3200 Atlantic Avenue, Suite 125
Raleigh, NC 27604, USA
Toll Free: 1-800-265-7376
Tel: 919-878-7978
Fax: 919-878-3751
E-mail: sales.us@ab-direct.com

Scandinavia & Baltic States
MorphoSys UK Ltd (Scandinavia)
Postboks 4079
N-2306 HAMAR, Norway
Tel: +44 (0)1865 852 728
Fax: +44 (0)1865 852 739
E-mail: sales.no@ab-direct.com

France & Belgium
MorphoSys UK Ltd (France)
15 rue des Pas Perdus
BP 38338
95804 Cergy Saint-Christophe
France
Tel: + 33 1 34 25 83 34
Fax: + 33 1 34 25 44 00
E-mail: sales.fr@ab-direct.com

Germany, Netherlands, Austria & Switzerland
MorphoSys AbD GmbH
Immermannstr. 13
D-40210 Dsseldorf
Germany
Tel (General): +49 (0)211 93 503 10
Tel (Technical): +49 (0)211 93 503 11
Fax: +49 (0)211 93 503 12
E-mail: sales.de@ab-direct.com

Worldwide
MorphoSys UK Ltd
Endeavour House
Langford Business Park
Langford Lane
Kidlington
Oxford, OX5 1GF, UK
Tel: +44(0)1865 852 700
Fax: +44(0)1865 852 739
E-mail: sales@ab-direct.com

Customer Service: 1-800-265-7376
Fax Number: 1-919-878-3751
Web Site: www.ab-direct.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Sheep Anti-Bovine BETA-LACTOGLOBULIN A Polyclonal Antibody, Unconjugated from AbD Serotec
2. Sheep Anti-Digoxigenin Fab fragments Antibody, AP Conjugated from Roche Applied Science
3. Sheep Anti-Salmonella Thomasville Polyclonal Antibody, Unconjugated from Abcam
4. Sheep Anti-Salmonella Shoreditch Polyclonal Antibody, Unconjugated from Abcam
5. Sheep Anti-Human ErbB 2 Polyclonal Antibody, Unconjugated from Abcam
6. Anti-Sheep/Goat Sac-Cel - Solid-phase Separation System from IDS Ltd
7. Sheep Anti-Decorin Polyclonal Antibody, Unconjugated from Abcam
8. Sheep Anti-Mouse TREM-2 Polyclonal Antibody, Unconjugated from R&D Systems
9. Sheep Anti-Human IDO Monoclonal Antibody,, Clone ZMD.420 from Invitrogen
10. Sheep Serum from CHEMICON
11. Sheep Anti-Rabbit Tryptophan Hydroxylase Antibody, Unconjugated from ABR-Affinity BioReagents
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:6/20/2016)... 2016 Securus Technologies, a leading provider ... public safety, investigation, corrections and monitoring announced that ... has secured the final acceptance by all three ... Access Systems (MAS) installed. Furthermore, Securus will have ... installed by October, 2016. MAS distinguishes between legitimate ...
(Date:6/15/2016)... York , June 15, 2016 ... new market report titled "Gesture Recognition Market by Application ... Forecast, 2016 - 2024". According to the report, the  ... 11.60 billion in 2015 and is estimated to ... USD 48.56 billion by 2024.  Increasing ...
(Date:6/9/2016)... Paris Police Prefecture and ... ensure the safety of people and operations in several locations ... Teleste, an international technology group specialised in broadband ... its video security solution will be utilised by ... across the country. The system roll-out is scheduled for the ...
Breaking Biology News(10 mins):
(Date:6/23/2016)... , June 23, 2016 Apellis Pharmaceuticals, ... 1 clinical trials of its complement C3 inhibitor, ... and multiple ascending dose studies designed to assess ... of subcutaneous injection in healthy adult volunteers. ... either as a single dose (ranging from 45 ...
(Date:6/23/2016)... -- Andrew D Zelenetz , ... Published recently in Oncology & ... Andrew D Zelenetz , discusses the fact ... placing an increasing burden on healthcare systems worldwide, ... the patents on many biologics expiring, interest in ...
(Date:6/23/2016)... ... June 23, 2016 , ... ClinCapture, the only ... Center and will showcase its product’s latest features from June 26 to June ... scientific poster on Disrupting Clinical Trials in The Cloud during the conference. ...
(Date:6/23/2016)... ... June 23, 2016 , ... Velocity Products, a division of ... and optimized exclusively for Okuma CNC machining centers at The International Manufacturing Technology ... among several companies with expertise in toolholding, cutting tools, machining dynamics and distribution, ...
Breaking Biology Technology: