Navigation Links
SYBR Green I nucleic acid gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)

ProductsSYBR Green I nucleic acid gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)
Company Molecular Probes (Invitrogen)
Item SYBR Green I nucleic acid gel stain*10,000X concentrate in DMSO*
Price 
Description This exceptionally sensitive nucleic acid gel stain has bright fluorescence when bound to dsDNA and low background in gels, making it ideal for detecting dsDNA in gels using laser scanners or standard UV transilluminators. SYBR Green I nucleic gel acid stain has also found uses in capillary electrophoresis, real-time PCR assays and bandshift assays. One mL stains 100 minigels. A 500 µL unit size (S-7563) and a special packaging (S-7585) are available.
Info Molecular Probes (Invitrogen)Molecular Probes (Invitrogen)
PO Box 22010
Eugene, OR 97402-0469

Call Molecular Probes (Invitrogen) to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-541-359-2658
Customer Service: 1-541-465-8300
Fax Number: 1-541-344-6504
Web Site: http://probes.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. SYBR Green II RNA gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)
2. SYBR Green II RNA gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)
3. SYBR Green II RNA gel stain*10,000X concentrate in DMSO**special packaging* from Molecular Probes (Invitrogen)
4. SYBR Green I nucleic acid gel stain*10,000X concentrate in DMSO**special packaging* from Molecular Probes (Invitrogen)
5. SYBR Green I nucleic acid gel stain from Molecular Probes (Invitrogen)
6. PR Competitor Assay Green from Invitrogen
7. ABsolute QRT-PCR SYBR Green Fluorescein Mix from ABgene
8. PPARGamma-Competitor Assay Kit Green from Invitrogen
9. ABsolute QPCR SYBR Green ROX Mix from ABgene
10. Lysozyme Fluorometric (Green) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
11. Amylase Fluorometric (Green) Assay Kit, EnzChek® from Molecular Probes (Invitrogen)
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:5/16/2017)... DALLAS , May 16, 2017   ... for health organizations, and MD EMR Systems ... certified development partner for GE, have established a ... Patient Portal product and the GE Centricity™ products, ... Centricity EMR. These new integrations ...
(Date:4/17/2017)... , April 17, 2017 NXT-ID, Inc. ... company, announces the filing of its 2016 Annual Report on Form ... Exchange Commission. ... Form 10-K is available in the Investor Relations section of the ... on the SEC,s website at http://www.sec.gov . 2016 ...
(Date:4/11/2017)... , April 11, 2017 No two ... researchers at the New York University Tandon School ... Engineering have found that partial similarities between prints ... used in mobile phones and other electronic devices ... The vulnerability lies in the fact that ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... As Ebola resurfaces in the Democratic ... suspected cases now reported, a new analysis of the Ebola ... correlation between the 2014 and 2017 outbreaks of the disease.  ... 2012-13, which preceded the 2014 outbreak. An analysis of the ... counts in 2014-15, which again precedes the current outbreak in ...
(Date:5/23/2017)... , ... May 22, 2017 , ... ... in a row in the Aragon Research Globe™ for Corporate Learning, 2017. , ... industry direction and market demand, and effectively perform against those strategies. NetDimensions’ ranking ...
(Date:5/23/2017)... (PRWEB) , ... May 23, 2017 , ... Bacterial biofilms, ... polymeric molecules, can cause diverse pathologies ranging from food poisoning and catheter infections to ... biofilms is in the tens of billions of dollars per year, there is currently ...
(Date:5/22/2017)... ... 2017 , ... Cancer diagnostics and pathology workflow solution provider ... Association for Pathology Informatics Annual Summit at the Wyndham Grand Hotel ... Diagnostic Cockpit and Consultation Portal, Inspirata will present research it led to help ...
Breaking Biology Technology: